ELF(`4  4 (``}Qtd`@`````` `ᆳ``}bb)hO,P 4 40 C PX@@ @`` Pd`MMOР iHM (B B H4P MMOР iHM4!(B B H4P dMMOР iHM!(B B H4P pMMOР iHM!(B B H4P O$MMOР iHMT"(B B H4P .MMOР iHM"(B B H4P MMOР iHM#(B B H4P /////////=Hb0@-@6H \ b`Mb@- @Hbap@-@MH @ A PP@`,  qa00@Ѝpbp@-(A0C$H$ `Q H  `00 `S0S 3/P @ LGM@DXN7Hq"pAP  -aX0TAP H @G[UUD`abH`}b(b0b8b mbDbbPb//0@-M@ |`0,<8 40@PG($ 0G 0G  0GZ z C0c0VvQNn`G@ 0L1H  @0 00GЍ0 aXbbbb$ b4 b$b8 bL+b@- ]b@oX b@-@nG@l b@-@eG@ b@-@\G@ b@-@SG@ b@-@JG~@ b@-@AGu@ b@-@8Gl@ b/0/}bL0Q P/00Q  P  00Q//}bP 0S/ SS 00S/R/}b@-$@0S,0  }b(0@-0 S$}b 0@-0S(}b0 0P/}b bp@-@P`@T \^P 0@0Tpp}bp@-@0Sp,@QP 0P hy@ PP PD`7^Pp00Up@A0P}b bp@-PZ@P x^Ppl@0SpU0X000J@P <0^P ,A0 R0  p b b}b b}bp@-tP@Q  00Q0@0p8@@@P ]P ]A}b b0@-M@ PcNAЍ0 bp@-M0`@PS 0 s_0 R0@TЍp@-@?0 00 0  880R0@-0$MP Xc  @$Ѝ0 b bD-`M0S* @P p0@0T  PP   ^0@0T\0@0  P=0TЍ0  E}b$ bN-r0M@@00SOSPi@Tk y?P `ADOEY  5]P   x q^P\P0@0XT {E<EY  ]P$@nE T^P  1^0@0TQ 6?P \P EЍ  5^P YE xVEt SET_@H\@\n@T8/E?NP}b8 bYbaD bH b bT b b b$ b0 /}b/0/}bQ/0 0S 8#8"(8#8"80p3/Q/0 0S 8#8"(8#8"8 /0"S B BR 0S  BR00S "S00/0P@- 000C S$ ^ 4  @->@0Pp@-M @P`S T ^0 R0T@T % <X%Ѝp@-w>@800#$48s#8 : #:S//bb 448s#8 $ S *"*a[Tb b̠< ̌Č Č-,8, M,, 0a Ѝ b@-sn p@-@P 0@pPen@ p}b ]0p@-0P#ddhv@&h  ]x ]jl0&jV X&$%<%Td00Q`p \  \X%<%TPpbb}b4D-PM` 0 @0<p0\` 00& \0000000$0 ( # ,0S 00 0\`ЍC$000}bbb b@-0 }bp@-=@P, h[Pd[U0 pPpP3@4p3-80S00p<0PuP3SP0U8000p((D$00pP b b b}b' `4`@-\@$0Sm@ D0 bRD00SD0@@ewC0D0@}b b- M  9\0 HQ   Ѝ}bD-M Pp 0 `E00`L0 Ƞ(0@L00" 00"$  0,@00  ` \x X \*,' %*'t%T0 qQḡa0S 8#8"(8#8"800Ѝ}bN-pQMP00Q0AP [pP `+ 0```Ѝ0w@PP [P\0+ 0XP$p 0 `Pr\00c0 [\0Pc P`PD`l@bb}bA-Q d@P[\pH0+$0X@i`E0@0`L0 (""$0L0(;0"(@0 0000 0  `b[H ^[0 `V0("(#8("(#88#808#8001011&\0"! &!!("(!("(!(("( ("(0c!0@`0D@pl@?}bN-CS O?E 0Cl0{ M\`040<0X0$000 da``hqlpGIP7@` 0  (Z00;4P 0 Zx,u(r2J2F2Ĕ2 W <W-``x`h````h`d`0 4S 0Sy @\ ZPp8 Pr8A[  H0SA Ѝo04BPc90 S k 0 bR0S S S`14Q 03/dA TA1 @$D_8<41( ^ <!00 0!00 0 00 0H A 00oAAfAywaAr}bb}b}b@ bL bT b` bbbh ba bp b bP bt bx b mb bbHb4 bd`'` b b bH bN-8 QMP& 0 "D Ġ#t$Čt(5"( ȠR,ȠxE'x \ 00Wځ WA`6 :ş#: S PS Ѝ:,t ttş#:x SA'x`\5W/ T5W  WQ0#ttx'xW AQڶ0#$48Sa @Q ʠ,ʠ\ D,t t x 'xA`Qoڰ0#$48S0#$48SZ RPD 0S 0 0Y  Q0 "$("(R R$ CR X R  eY0 0R  X]YX \YY\`0X0$0`0r0#$48S0#$48S @3R0C '4PS  2Y 0L n@H0 @RD0SA 7P, B Y 0 S Sr/0#$4*Z( 0S S#!1!#Ġ"$8(#8!"(0C@ Qc Q# Q 0 ,p  00X   X 0@ X , @X Ạᶠ  0 Z0("(#8("(#(0G 0 000  0S 8#8"(8#8"88#808#800SH?객bbb5 b b}bxbb b b}b}b b@-@W0@(0/S0/S @TD-Mp V oW ` @0̠\#"̌ČX0%!ČPP R@ ,X0T@DA 010000܍L+b@-M@ X0  # 8#4Q ۍ0S 0SP\0T 0T0# 8#400# 8#40꘣b0@-MM  W 0 " ("$Q @ Ѝۍ0 R R RPU W꘣b@-M  W l0 " ("$Q ۍ R R@T @W꘣b0@-MM  W0|,#8 #4R @ Ѝۍ00S 0S0SPU0 lW꘣bF-Q@|!l |$ t ĉhM M*t&!`SĠ0p 0p|0` ;W\0To  P0T  T0P<`I Ѝۍap %W꘣b}bb@-<L!, L@M!D D4 0@ @Ѝ蠆D-MV `@ <,$<4("4pP0 Tp00C1 !  VWppP0f C1 mڍ襆L0@- Mr 0Sڍ o @ 0dC1V꘣bD-MU P@ ] `V<,$<4("4 0p$` Tp00C1 !  VWpp`0e C1'ڍ訣b@-MM` P.t p@V, <&%,$h,0X&d%T0g ( `$P C1Ѝڍȣb0@-MM  @0 P PZV0d C1Ѝڍ0ȣbp X00CS.`.`.`.`/`/`.`/4,\8b`w0d꘣bbb@-aA0QS l0 MhP \0R1,4, ,̠0Z\T|\R=\\pXa`00@\pkDD=@@ @=80S ,10S  0R 0=Q\` +=Q!0$=}0ϠT X8U Ѝ@|:TpP :P\`Tt=lQ\TTbbxb}bbb$b4 bbPb}b}bbbb mbbd1`l4`bbL+b40@-(R (<0 @?꘣bb}b@-MM  U0@,#8 #4R P Ѝۍ0S 0S0S`V0 ,#, $8/Q#T `\ T\zT p\TU\0Pp`\  JU\0`꘣b b0@-MMd P XRX00 L`2X`PeP}bLbbbbPbbbb bbb@-D M4P8R  QT$R r 2`B0V0a 2 ,4, ,̠0X R`:aq: :0S 10SI a!;:Q p:hO ;X1X|:Pe:0 D 0 4A`E0000`od1` 505B; 0S<1 Ѝ@#:R`P  Q00  0R |@: Q`$b bbbxbLb}b4b$b4 bPb}b}bbPbbbL+b mbbbt<`<`bbH0@-D@  R ,:$@9@.Lb bbbt<`bD-BM\ ЍQ \S`C,4 48#8Sg SJ SV0PR#48#8S0i 4ŸC| Pr Sx QQTS f!Q0 0 0 R0!@A4$1`F jR1@ T@v1V*p9l1 0V 04q @P0V@ ,#QPP RЍDR0#$4("(~9g9ЍD Rt 08#0 i90 # 90 `[9ЍDzP @90 Lb3Ɉ bbt<` mb|bLb}bbb0bbbb-c``P@pMpp} pS5`@9pp @p@Rp `̠L"̌PČ6p@(p"$ppBBBtp S  ̠2@@#̌LPČ8@#4``CCxCdp`007   `@ @\@ 00` 0C@Q Ѝ/N-aԱ0M0P0P8@!_Q+]0q@00Pbl1P* Ã(#3Ƞ,<,40YQ  , PTQ  0 POQ  4 PJQ 8FQ 0 BA0 8< 040}b0 젊0 # 8#40 #Q0C  cD0LL 0@0) ,Ѝb}bDbbb}bMbbC` 4G`{00@-0S @q'8@\bC`bN-0MS@o[ l p  CPBRcE`E`E`E`E`E`E`E`E`E`E`lE`E`E`E`E`|F`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`E`hF`E`E`F`E`E`E`E`E`E`E`E`E`E`E`E`F`U PʀPt1 pP@V0SЍ DP 4P $|P7 sPU U l0S00S 7 h_Pp YP?U lQP p xx07  X\ 07  8@@07? Ԣbbb}b}bbbb bXbbbbDQCRN-@MSЍ0 CSRS0S0S0, 0 P 0R R R RU /7`PO 2R pR0   R 5R0S O l2R  \`O O0S82 l@(ONPRp0S 200600P 0nSZ NP %}0 0O |1RD qxP!O+0 P`  00`00!81 Ã43:8#̠#40zO 8 vO   rO  nO 0Bm0`cC D0 `.x8g0 0LP  `IOwTgb8bcSc}bbbbDbbbb}bC`bbMb}b}bxbA-@63 0 0PP 0`p` 00 r  A]6P 0tPS  h00d  0 0S E Pa 0!! 0! P!b8bbXbخbaPb@-000/00/00/R@-@00S/R/00S/R@-0 @0P0 \0R/ R0/00S/ R@-0@00S/ R@-0@0P0 \0R/ A-@`RPph0P1w'L0 x 0 P0 x0 P @V g0Px 0P@\0 | 1 p@-p@P00 pp@-@P  pN-M␰  @PԐ`[ `P` Pp  [p`P0S 00 QʐZ p ` 0  pP00000Z`ЍN-锐@LMP   p Nh `EIh0fPp0000 00 U   0 UE^lږ1 P0  O\0I R 0B b =  !  0 0  U0#ژ 1! 0SpP`0 0 P0000 0`WPЍ 00    00u10N-M S @Pᔰ Ԑ` p ``P  PU p `P 0S 00 QʐZ p` 0  pp00000Z`ЍN-@MP P pᔰ吐Ԡ`0 0 00S 00 QY" `p   0  `P00000YpЍN-鐠@ZPᔐ嘰` ; p 0  p `P0000 RZ   R 0`0Z`  f0  Sp@-@P 0P 0 p0N-M@ `0 Pတp00S% @ @@ T@   R 0pd   \ 000W  ЍA-`p@P0 0  0040N-P MS 0 @ p倐Q;  0 R9 0 0`0 Z 0 Spj  0 S Q Z  bZ 00  0W   004 Ѝp@-P@  pN-鐐MY @ 0P`  `p`  Y p `0S 0!  0R  ЍN-鐰M00[0@0P` p   0[ 0p0S 0!  0R  ЍN-鐠@Z`ᔐ嘰P / p   pR PZ   R 0P0ZP  e0 p@-0@` P0 00p0 | 0 | /@-@2L0@20|0 S 1`bp@-@ ` P10`` 00`` 00` 00` 0 00pbp@-@PL0 P p 0mS D0S4D00S400S40Q񟗩`b`_`a`@_`a`0 R R R S00@$ S8400 S(400S40R* M10040303030303030<000 1!S   !1S fd 0R t1pp--l31hK L0  t0 0St Sr S00 0 `23p0|`0l000 ( "4 "@ "D "L ";P "0l L0"x "| " 1" 8`<`p`t`L0p2P Ep0 S] 0P0  D"20K RQ 0SN 0SK 0S\ QQQ90D! @!0 `! 0X!0 0\ 0 S !S 0S `!S+`01P!0eK0Q @Q Q10Q m000g0 0b0GK 000000000e`O`|Z`U`P\`DW`X``b``LO`|P`Z`W`\X`b,bLbaXbXr`Dz`l`w`l`]`]`]` FT;: 0[T RI R    0DP@T hp      R`0Q@d 0@0[.lm `c0F0T``m  G0m? 0 0 bTb0p@-S@\|\PS 9Pp PU P UP3:PA-@ `PP0 Rp0|0000 0 00pPp3:D-\P@p :\  0-H@0 @F訠 1WS B` S`1`! xF@ pW 0SQ R R c *`bV`! ,bLbaXb 0@-0 M000@SX 1@P̎@L0  PU000 Ѝ00x|000  P;N-P@T03 M`p  Ѝ  0 S 000 |0\ P0:"T c  ,0 0PL #W  R! :!0[(00 P 0Phl0 S S0l0h 84 @\` 0 Q>19R ʿ 0S H \0930P0h9  0 W p0 L0 ,0S iZ h  L0 000 00HT }\y PA-@ `PP0 Rp0|0000 0 :00pZPp3:QD-`P@p W (v  L0 `( z ` (J (d0SG (pU UU U,0S< ]TDU`U,0SHPTp ( (P@UPE@ 0V`c P#*VlFà ( J (HDT@ PQG-0P`` pP@(00  S  L0 `( F( Y (J (d0S1 (vUrU:HGSUUU,0S SGQUBU U ( (U  UJ (0 ( (,0SHSp ( (DP@UPE@ `UpUU@ N-@H0 S0H000LS60040MS6400PS50RW R%  R% $ R%$  RN  RS  RX < R%<  R  3/ 00 00p 0`0 WV  o0S 0V0&0V  Q8 0S0 0 0:d00S4 "   0@$0S W0W 0PL\= 10 (L0[  (( Ѝt0@!3  @$ Ƞ" 0 0(((0S  ("(RC8  C4 C2 C1  Bd0P 3" Bh  R !QB(B$B"B!ASXT  !QC(B$B"B!A! \  Q  WxL  Q L @!!8 8   RX!0Q!0  zjY `!`[`Y 00 00P d0 0`` 0Cd0 Q  Q   RQ   R Q0z``r`dd`\L`M`ln`H`lhblbbPbtbba^`X]`|`HL`8L`(M`lL`\M`L`L`M`@-@OP@)@-@ M@@ @0 L Ѝ0X0L1̠ P /P/r3/N-@ HMP{` XPa+  $   $s ` SXd A2!  Q(0`W6 040R0D0Q@P1N-M  R @   00 0Pi s0`00D0D0 D dX\0Z A@@ 00 0 400(  0@< ,08( pw*`8040`P ,0 CqWQ Q XpPZpaw QR0$ Ѝ 0 0C S긕`P``x````` X0 2# c, 0S1#Q D0H0`0000P0$ X0300c@$  0@P P0 >3$0 0 LP 0SP$ 02GS& <  0)"0  <  00PfLp p H` 0 G!pSP0 S"!p^Lp0 P<$TX0 3 PX0PPw  0 0@ $ PPe <0 $  <0#, (D \p804(, @ 0 804E0, 0 H0P0`$O  A^ a 23 #"X< 0  e< i00H`' 000 0H `0Q 8#+  ##bbXbbbN-霐A0MST`Q ЍX0 3P S"0 %pP. 0U \ ;  U    0U00 0   03Q$ 0)P4# b0N-MP@ ` 0d SX02# ЍX0 2# c 0S1#Q  t1 p0 S`! 0 r XP00cR30 " P!?  R700 Sp 00 S 0 0  cS㉐ 0 0" !QP \ 0S X A>X A8  N-@0X 0M3< l< RA0Q,!1$ (0r&P& $\ X0 3P S"0 :$P $ 0   0@(\ 0  qA0 U `P7  r]  R{ 0a<S0 00 00 0 \  0\ 0 H0T0 0 J PU`0 RT*   r  rC 00 ` Q$(0S !# 0Ѝ0 0   r   0P 0P   , 0AT$ %(\N   qA0 IP0 #0$ 0 $  $0!'P0 #0( 0  (0 ! qA0 p, 0;0m 0Pq H!"$j0y!" bq! ^bHbb(b0L  (Q|$L l(!Q! !R4 !$ !Q( $B \ \gbgbgb4hb0-p`P@'@ &@0?@p `  SP%L@021@,1 ,1 10p`&000/ap-`@P0@& %,0  P UPUU 4 ȓ1 0 P*p/P#UPUUP,TPTU`Q@` P@1PP@"2P0AP@"10@@"0,0  Π π," Iq0/ / 0/ 0  /p(000L0000(00H0/L``00, 0@@-AS@c@x}a0@{a0@@-na 0A_a Pp@-@ 00AQp@Q0AQ Kap@-@PPpPp (@-~S @x} A4@-|@ @0   @0 /@-|@ @A4 0  0 /0  /0 //0@-@M   |  hxP Thd:7T P H@8Ѝ04bDbPbXbdbpb|b bbbbb0@-3/Rp@-@ P8`@D @@T@p@pbb///PP@-`@+)4/bPPN-@MP`."0pS3 00T)pS7pT  !p 6A7 TPp`@l]( 0T 4/Ѝ@4P0 &0Sp,bL+b bp@-@;&PP p0,#,$8#4 S xp'P F'T*'P@p4p(pxbbbV'bbbbbRA-@p`P  ;8PP`T0A mb@-@(0bMN-M=CdZ P 5CdZ C   m6 %u[ 2@P`/ 0+ C Zo  00P F I`y`? Y`ڊI DU`3 SU0 000S%0 %  0  0  2pPR VQ dBp7TBY PD`1 d @HL G C0 ` `,"/?  S I @ _))` ) <#??0 0P0 SSU BU 0 00@P@c`68b'b'b(bPb(bt``l'b'bx b|(b mbXb'bT(bN-Mp@@R`" p`0Sx [ )``````````$```$`0`0 p0dSf - 0'P_@P,```$`$`$``````` 0H0`S PH V: `0d p  @  D#0 0 S 0! 0D30C V:0Sp7?2cd W ` @@jA0 t 2^@ B T'5H@ߍ \.Y `wlnbt'aQ'(bt bx bp@-@PP 01S" 0 T @" NP@AdU 9PP ;AdUt `X0@p<0 T @ 1@p4)blnb@)b|(b mbd)bRD-@P# 00 0  pb+ G  `0H]T0  00`W0pb*bR@-  0,0$>08pb*bRN-@MP o0T  h0Tp  a0T    X0q`@P'0SY0  ["* 0 S : P @\0@ P T:Zj `f@P pЍ8Zj `f I$+bL+bP+b\+b*bRp@-`PP 0 @/P U U P& 0 0S pU U 000000P 0 0S P 0 0S RG-P F@P /` p/ P/Pp TMT0000Pp T0P0ppb+bRF-P M N` Ѝ @P` }/$a pv/ Pp/P# 0P T R)PP0 T R `  R x`PT` X0TT  PUL00D<`` pb+b`,b+bT,b\,bL+bH@bh,b,bD-@ BR`P /t0P P/T0p Vp VppSP0C  .0P 0CpbN-SM`(CHq0B <e4U! U- p#P P0-S  .0 S U UV@~UyP#PV P 00@pk0Ѝm+PP  .@@pbb,b,b,b,b,b- M0 0 Ѝ- M0 0 ЍN-@ȠRM `Pp&  PP  h.`Y`H 0e&)pP `Ѝ  P.ppbpnbA-`Pp?U@  8._Pd>>UP- M# 0S0Sx  tSp  0d Ѝ0\ Q Q 0\$4b/b/b0b0@-@MPU% 0S U  U"( 0 S( XЍ0 0H ("( 1 0Pꄰb@0bTb40b1S 46S ;#;S  $1!%1!/1!* 1X0bT0bL0bP0b0@-PM@T 0Ql  hQd @ 0 T1DZ 8+Ѝ0 P@ꄰb$4b/b/b\0bd0bb0A-@`TP$@ $q P5  Q 0T  R *0T 0 @` `0\Q P0`` 0RJd 00 0 0T000@@0脰bp0bA-pW@P00@PPW`@p@-@ 0P0 PP80 T p QP PPp脰b@- @, 0G0C&S+```````````````````````````````````````  @-@ M` Pp+P000 0  ,V00 ЍTt *P00H *P00 7$4bwb0b/b/b0bN-БM` ZP@p 0 [00000[ *PЍ Z000`* 0 0 P 0,Q0S 3,0Q- 0 S0 S \ Q`0P`X^00< 80^40$ꄰb0b81b$4b/b/b 1b0b0N-s 0  0b0 0MR@PRR:0S| x"Stp 0ЍSV:0S8" 8S," 0 0 / = ` pz0 0,Z, 0 p \ P; `0 R3  0\ Zp0Sx t!Spt 0Q\L`EQ; 0S !S  0830p`0V S#  00a\  R:pZS 0S\ X STh 0 voEQo8 i$4b/b/bt1b1bX2bL1b1b1b(2b1bN-00M0$ 0$ :$ ( p)P6 @g ` PUPU )T m)P`;)0ğ S 0 S  Q R0 V 0S ;S 0 0PJ D)P,`,`` 0 0,`,Qh ;QQs(  = @Pi 0*(Ww  E( 0PE0@s@PP 0$ ((0"(V(@ @0 b 0S_ ;S] ,`0-S, ,P;,0@S- (SPpp),p(P, PgPU6 ,` 20Ѝy' ( ` ,` @P"$:`,,`d,0Y 0 ].0 0 PR 0S !S|0 V ;Q1 Q6`@P;  )00@$ 0Q0P0@P 0` 0U P  0``P 0@0``|t 00v\rnꄰbb2b3b\3b(3b2bl3b2b2b$4b/b/b|3b2b3b4bP0@-0PMX  TPP  L - ; @ p00Ѝ0 s$4b/b/b1b3bG-d @ TP `p`00Pppwi V@P脰b0 @- ( @ꄰbN-V0M(BT    0 0P  '[L (P0SS ( P7*,2S!  '@P0S1 (0S t'P|Tz 0S 8E P'P6( @P/ E P` pp00`W` 0P,2 @$@L RI / (0aP0 0 =R0/($ 0AP6 , 'P pj0p 0W 0Sf /( 0S` Q QP 3P PP0` P  0``U0F0 0APLV h )'Px 0 P ' 0S$ 4C `  P^ 0S b0S_  P Q\ 2\ZF   `Px '(0 0/00$0 0 G &0p00G `$0P$`@0` 0SR  &@0 00$  ',(' '0(2 &pP0Ѝ|  0P@0 0S 01@R9 (,V&0 0(0S  ̰0-*l/ (0PP/0 000^dꄰb4b 4bd0bbbb$4b/b/b4b05bbp5b,4b<5b 5bt4b4b4b4b\3bD4b5b0@-M@PXPT 0fP Ѝ0`0  '00 R< 8R4 ,0}yꄰb$4b/b/b5b5bN-Ԣ"08MS@(@ (+p2W 1@06& YPz0  ':0p0 @` V Pi@t p0S U`0r  o  PE@ 0  R *UP ,0PE0` VR 0 0 %`Pp= & 0y03R0SPg@Y  0 R  % Up:@00  &@Pi 0S%0Sp(  0&0 @Pc)0@ 00@(08Ѝp0` S U ;00pW Ef1@PP(@@T@T @ꄰbb05b 4bbRN-PhM`@ dPU 0ESUU'  hЍPB H&%pP 8!%pPE$8E5 %P@`g \0?P`P\@0S 0U  0 00k00C0P XP L$P\ g0P \ PgUPU 0S 0S %p %`% 0 S ` $P``?V \P 0hc*` Pn`0Sk #@ T @ T  R RP<Pk `Gp WW 夲 Q Q  0 |` p @T P 0P @PTp W10S,  AP P& 00 R R  0     x p h DP# Dv  @00  P T 0 R 0ܕ0C 0̕ 0 00g 00C0O  0 0 0@00 6b6b 4ba4bd0b7bb7bh7bL+b7b/b/b$4b6b@6bd6b6b6b7b4b7b 7b08b6b6b7bl7b7bD0p@-@4$P0 `Q   "%p@ b=b=b=bN-M0@ .p`#PP #PE  P00% 07P18uP 8H Ѝ9x 09,#,$8#4@0 0k 0r7P0:b0`P S#@P 7RF#P A#P | 4Ad@  0 ( 9/ =b=b(>b mbt"b@>b>b=b=b=bD>bN-`0XMPp, ) ZPe 08@0c P$0 D00< 80PT LPSh^ + @* P @PU@# W 0    $ (,03 PU@ B PQ  0 p PU@ ' % XЍ<  ,   >b>b?b ?bt>b>bRD-@M`PRpp 5$0S 00S P 4@D|T ````4qЍ 0P0 0SWT5W t ! Pu@5LT9 6H #P+A 0S' 7< 0 #p\@ #@p # @p #`{ 6L` 5 8Z  #  0b`?b?bl?bL?bN-PP2MP@`p8r  #0SP   #0SC< Ѝ00S P 0P00 RY QP p  `#0S/ 00S+ 00P000 p !" 0S)  00S0S    4#0S 00S x 0`T 0S @T8  8bb?bb?b?b?b?bN-pPMPUpP  "P@p>!`P  : X7 0SV }@PЍ0-!`PU  "PPQ6 RM  s 6@P  6@T; g @ !P0S|f 0S~  0P,p0d  0  L0,@PA 0LR50S1@ P( L@( @ P|Up` 5@p@3T& HjD%L0P @yL P @L 4P !L080TH040@`<  yPu P0D0pn54P@@T@L@Hy Po  Pi  { Pc l u P] ,b PX D] PS X PN  S PI N PsCH P}  P P'Ue .c  @!TL / PL~  @p@3p# pPZ p`XLs@ " P?U7 ! rH  2p3YkE  L0PEY0H0Cp. @P PEY: 0L3@H0"T20@C@T@ P PPU @/@PU  l!pL PL ~ 0L4@Ht!lP \P (P&@ HP 00Y 0 P00  |LL@PH$;HP ,LP@@0@b @bbd?b<@bL@b8bb@b@b@b@b,@bh@b@b@b@bAb BbBbWb@bp@bx@b@b@b@b@bBb@bAb=b|BbBbBbtBb=b=b Bb bPBbRp@-@PP0P 7P0ppp~bEbEbD-P MP`@pKP  ,3T TY T {O @ Ѝ  @?0S2P@PKQ2PT2PZ0S`t0Sbh2Pp\2P5P2P]D0ST R1 P @Pf @TQ0T ^ 1 P@PP@P`1P PtX 1P Pj40S 0S 0P PS0S PH0P  b0RT 0@PRK@8b mb}b}bbԢb}bxbbbt"b@>bEbbT b@ bL bEbEbEb0bEb  0/tnbA-@Pp `W0P=S@0S ` =P `N-pP@ P `V` P P 0JY P Z0 00@-< PubGbA-dP`p P @T@ { PPAi pN-M] pPg `=P @Ѝ3  0S P@0SgkPq0PS@Yg0Sd 0 @0@R  RW@1P00P0Y0{pdW00S 00SP=  0   R0 P t >P@@h5PW0P@ `S D  0 R0DPU<$<,4H$40@|G @yPY?PP: 0 S 00S000S @`^@UPP <PWPE20%00[ @P0 @P ;37@. w P0   S R$@0+/00l&/ P TH0Gbtnb b0bHbbHb HbHb8bDbbTHba0Hb'bP mbR@- @-0M8 Q   Ѝ HbF-@QMp$ P`P% P T/  PY   0ZC PYTZPTPЍTPZ  4FP PP@RD-@p PT aPP DT P q HbHbA-PV ` P@ J@0,#,$8#4p!S h;D PE V50S.@@l<$ld8#dDP=@TpPPP@  @Q! `Q Q@F0S P@|@" P`0S@< @O$@bKbV'JbJbJbJbJbR@-E .@@u0KbA-@$p`P 0APKbN-`(2M @P T+ TP$  Tp  : P` 0,#,$8#4|!S tЍp P` H| P0 0S(0S2Z  P/ {_ P  0 T&@  x  q\XtThOXK   mbb @DP, 4KBލ0@ Ѝ/0@-AMM  @5 @DЍۍ-@-BM@B> 0 @D (4#Bލ@Ѝ/@-@Q Q ppQ P@P@Q8(Q @(bObWbPb@PbOb PbHPbp@-10P" @P0P 44 CT U\@QPTU T U  4`  (P@@ Tpwb(b-@-BM@B> 0 @D (4'Bލ@Ѝ/000@-@@0S 0SP P0b$0    0S/nb00 P*/P/8b-0  ` F@DF T!P*p`W /`Pp`W`dUP\pV p`  cR `a `  d  0@d @xnb8bP-; @:4S"S8P" 0 S[0\ R: 0 /`pf P ` `S[PTS"VnPUSWwPS"Y|P?Π~P!B13!00 0  l 0 0 0R0:P04;0  0 EQ %  xnbnbT8bdPN- @T0`@4@~T/:da V$c8`EDV Q S Q   0dS`F`şQ0   0dSS  000a1U0 P  00  @ @@0  V[`TV$fn`UVgw`4V$i|`?~`d$Ē4 |  . .   Qt: QzU p WPP  W00 07 |g@ l   b  [t \r, p jP   S00 0C0  S0  80Qd38<0Q  L3<dQn  00  Rn:4S"à8qS[qTS"Ơnq USǠwqŸ S"ɠ|?~~qp0tS0W  R: 0 0F! \& F 2ᆱ p 0WGR^ 0WB  dR Pp`@ Pp@ @ ` 00dQ #0@@00 S` p!B13!0  ` ` ` p 0`F& [ \\  `  ` 00 pL ,  w  0 $xnbT8bQD-@PDKP  @Q``?pP /PGQ D0d  J 0eS 0ec   00 P000fS0000``t  P 0@@/ 00@//P3a$4a4a4aQ /80 /,04/0/ 0@/xnb8b0A-P`pU@@T 0D p S``R`V  B$RR0R0$R 00 xnb0@- @8bQN-P@hP @ `V ``Y0 @ L@D 0\x @@@[ 0pS pg@@] S| @T@W 0 0 0 I$R0 OR 0R P00$R0  P00 0P0 0  0 fQ 0@@000 @0``000{ @T 0 00  @TX  0@ 0S 00f 0  00``@N @0[@ 0 I$R0 fR0R P00$R0  P00 0P0 0  f0  00``@P 0 DR2  I$R(R000R000$R 0  0 00R@ @ @:xnb 0R00/rb 0R00/rb 0  R0$0/0S0/rbN-PMPA  0fpP @@P 0R0 PP=/P`e, WV PP 0 1 Ѝ  6P R00 V0S   0K 00 fP` 0 1rbNb0@-@ 1|b@-0@(   |brb@-D@0S    ;   |bhPb0/    /rbN-`帠@MxPY 018# UT 0+x *P @ UTP:UЍ 00 $ 0DP0 @P bN-`帠@MxPY 018# UT 0+x *P @ UTP:UЍ 00 $ 0@P0 @P b@-}@`Pb@-8@P  00P@|b0@-(MtG 0 00@[X%P Ѝ<Q80f@P$IEPbbPb|b QbQb//G-p@0 0pS p ` P @ 0PL H$D8@<<,8D4(0H, L ?a?a+a<)a a8aa a4a0a@a0@P/D R0/0\\P P/ /80 R RP //ubQbH0H R PH0 H0P R/ /ub(QbH08!R PN? N?P R/ /ub@QbH0!R Po? o?P R/ /ubPQb//0p@-SP@ 0S 0S %Ppp XQblwb dSbvb dQbub Ubub0 ,# 8 #P/V'@-\@`( D@T Q *Q\ \|T P P1L#L|D8#400PP@ aPP/@-@1@ hQb`Mb@-$P  @f0tQb@-$P  @Y0Qb@-PnP0@-DM@@ 0 @ 0 0 P,#,$8#4PDЍ0 0@-,#,@$8#$@8l 0,#,$8#4PD- P0M 0S R R 0S`"H0S QL DQ 0S,81S \r \n 0S1P \_ \[ P 0,#,$8#H0,#,$8#$@u0l,#,$8#$k0S S Ѝ@0S7 0`D@`T0WV  p@V 0  E 0ST\ :0  z000}D&ObQbQbubQbub(Qbvb@QblwbPQbQbQbQbQb RbRb,RbF- M(p,P@P@`@ D0S "0S  ЍPk  8@{P   0w@TQ 0@0 k0`,#,$8#4d!SGPI ZV 4P-  L0S0 S 0S  0@@,#,$8#4 H0S ZH  H Z 0S &xr  0Th  z@b  tDRbRbRbHRbV'bbub(QbRbX b, b@ b/@-@ 0 S S0 S S S 0@S S 0 SS ST  S1 >UbN-@MTPލ0S  P*IB.  { 0 @P0C@D0 P0S  Q R;SP 0R\S0S 'SR\P! 0 0 0P{  0\V\QP Zj `J\RJ R \Q'V00SQ 0'` PWZR RJ`\Q'VQ'` `pG)V}V 0Q00  0S.0 D,Cq P 0S pW00SQ 0 (V{V   0  $pW 0`pG$V  R 0$` Wn `pI pP  S  PP2 0W 0\  H0 0?00V\ 6 PUP 0PQ0pPP03P(0'0040"P (4S $4P0"S%($RP00 (S"(  4S 0pP 4 $4PP0P4bb?bN-BM,4p` V  S RH 4S,P 4$CRE R= (0QC404UPE P {a {04SG 0,4[T,4STVPP $,4 `e$V  S eRp Ѝ0, 4 $S 0$ 4$R $QP$ S 44S 84$40S84 0c4(0QCX4040O04QPQPR0QAS BR$4 44bF-8A MP0 P#($T,T0T C0$TT T$T8T4T4S 4 p g`P v v WpG` ЍJZ(T(0QC4044S <0 R,0,z0 0$0 44b bhb0@- M@P Ѝ0 0PP 00 0 0 0 oc_YbLYbTYb Yba@-TML - @P 8 'P $Ѝ \Yb bdYb` @-@q@{@-M 0@< ( @ V Ѝa_ Q@- 4@00",S$,("(/aR-3@0`P` `q` 'P PqP '` `q` 'P PqP '` `q` 'P PqP '` `a@D &P PQT %0 B00 R ,0@0@ @AR $/aR-3@0`P` `q` 'P PqP '` `q` 'P PqP '` `q` 'P PqP '` `a@D &P PQT %0 B00 R (0@0@ @AR $/appD-@GpQ0PV[Mpkp`Q 0@bA P`@ @@<NT ,I DDApYbxYbYb@- 8baN-HMh@P@R@e@T_@[㐑a T @!TI 0p`  `Tp0U8C U 0` Tp00W00 0`{V0 *`0.qV0: l~P[ 0 T @!00\TT YkpP HЍ (!wb,b,b,bQb,bF-DM$@(`pP <04d P0 pj`5 `p0P0W0Sp 0`f`6 DЍ0 |) {a{aYbYbYb0@-\ MP!    Č @T \* Ѝ0 @T4 0YbYbP/0 T0P 0 0 X0\0/0-SM[ S @ R\``[ p\PT Q  S `Q@PT\I \0AP bPP0@PCU T= Ѝ/@1 @0@PCU` q 匡 Z጑ W 0aPPE U01 U0P@ @T @SU0 Q10:3 Q*PE@u @00 Q5 50`P@P1 i-P@T= Xp\00Q WPPP` `pd0`0Q WPTU# WppS`` @DT PQ Z P:P@/WV  A! dP a& 01 b P1 b P00-S P  @@Q*\*S0/ R:N-@\M@ 06J⌱b0S*: R= 0PaP 0U0Z0S P`V% 0 pX\@0@U*\*R*R QQPaP Z00U0S@K@T@ZP  R: 0 A  PPЍ@Z* 0TPaPa PP0@-S X\   BQ\   `d@@@DQ\ S/p@-P@`P pZb00  R0/0R/\0 B/0S  0S0\0/R0- 0S 0S P0@@T0 SP000/0 0lR/ ̠L /R 0 0c0\  0 0c0\  R/L0P"q@D00SS S T:0PEt@T*U $P(0 S 8p<@;0S3@P 0@dPe 0 0 0TR00 0SO d 4 S@0 R  <P\00\,0 [ 0S@ @4P ( R P0PeU *00  cRp1p!e PU0 (0 R0 , 0PR 0, 5$0 #0,0( 00 d  4e (0,00P Rt 0DbQ*00aQ( c4 40 a0a@ Q!0 Q!0a a00@   0Q@0 S0 00iH R00X0P (0( T D0*U4 (U 0PEt !0@S ( D05(001L0L 0H0H0 (3+0( 岰 TP *U HTHP`(LU0 0PEt 1!0@`V HP`T (D7{@`@@c7s 0D 0H$ ( P4!0000S 3/H9UPT0L 0(!(0T0(0 :r0PEt 1@Q!0fUU 0PEt@T:"@H0 7s@c@ M0 U  PEt@T!R D80 00* U{ 0 S $Q (@0S 7@5R[:0(  (0 SPk`0 0 UW 0 S Q @0S 7@5R[:0(  L( QPk<0 @ HQD ,000`S0#0%*600BU! 0PEt@T: D H0 7s@cD 04 R  " @ U1![ Q P 00b R c 0 2@ Pk k @ R0 @U  PEt@T @pRp0,p@ '4]0\p\ p@00@T7s0PEt@TU0$0SG 0SCU 0PEt@T0S 4000$0SU  PEt@TT W  R  Q0000 48#8$'4b "ዲk S0S 300h` d00(0( Q9T L@01 0T :=0PEt01 @R03UB0S U: 0PEt@T 0k000Q00 0S 0 al40S','4,<0,$0 R1@ 0 pP 0@ @  0h0\ R( T0U PEt@\Ph0q@DS 0 ı S0h0,0T0lL08< 40P>0 0ha@0Sc U01 S1[  @0 0k@0 0 k 0 0Pk  0Q Q$ > b(0,0000 RT@  `)@p R400,0  004ba[b\Zb\bB4bZb([bZb<[bZb[b\[b|Zb[bZbZbZb[b[b[b($\UX PEt@T:⋰7h@b7rh  (0RW  02(H0031 D !D00TL00*U* HPHL`(U 0PEt 2!1@ `V!0DL`HPD7q@aR@k@07{% @\ 00H !8#8'("S@ p @00  ;207q( @a@ 000200'4]0\p\ 0KHP`T$'<''(]^ _0\p\  "   0\ @p\0t0]000 07r@0'4]0\p\ (0@a@07q}T:=0PEt@T7*Uz7r00b@ s(0 SD :8 00SDhh$00_ 00yT:+0PEt@T%*UM   af%[@b7r 0'q@D400S4000NHL`P$,7r00b@q0S= 0T00,08l0L0<` 405Pl0`P00X0@ 008 40d %P00, 50 0 0050 0  P <@8p 600 600'r0$ 0S-T6 0@D 0@$pc P 8p<@ h   P8p<@060 0600 3 0    0 0 @0 p4D700`700t70 0700(010#P0001/ $0! "P / 0   P/ 0P#0 / 0p-#0 S(:+\aA T! RP P 8Q PA @ @  00 S/P6C@@  0#0 S( P:C@@  0#0 S(d0, >#0 L 0 D 0 00p/A $04@1  0/@D, 0000000/\0\  @- @O/l88 40LLL$ L$(` @-w- M??00200?/??00200?/??00400500?/{?00:?`P  H0P P<0"R* Ѝ |P s\b@x}\b@0@-400S S( $\b\b\b\bl0-xēTM xăp40@Q @ G0( !"b0b0P 0STЍ񉈈0-4 M  BR Ѝ/AT P 0&(S0`#$pP S 1RU P!!P01S300#$SpP  0$ &(  Sb(0( $0 "#"# /xbc->tbP0P L0 "#‚"#RS bb /xbc->tb(0( $0 "#"# /xbc->tb@-@d0/tbP0 00\ b *\l  Q/\:/xb@0 0  ( 0#3Ã#30/xbtbc->N-@p` WWP d`p{P  @@000 00  $ U00  0 S0 S SdQ h0S a 000PPPxr  7/X00A0 "!$ 0 ! b]b]bAT|bATBT,]b AT/M000/cS0000cS:?Ѝ/M000/cS0000cS:?Ѝ/ /M000/cS0000cS0?Ѝ/M000/cS0000cS0?Ѝ/ /@- /LD]bPq Q0/X01PPS  / $0 S00Rb00CS0/ T]bl]b$<@-!R0S1 bx]b0@-S@ H 0P 0 S $0A bT]bl]bp@-\`P@@ T 1S P 0P 000ppb/G-RP@ p p0c`C``f @p0PR  R Z:N-`M @pP 0S 0S<G10P9 V )  jR ` p 0@Pup 0`cVpP jJ P a0VPPj Ѝ\ 0`f` p 0@upP  ]b]b]bN-`J M@PpW i 0 S 20P@ V '  jR ` p 0DP" 0`cVpP jJ P a0VPPj Ѝ t 0`f`0S p 0DP  ^b@^bl^b^bN-MP$@ 00  0圠! T0 (Sx$P, `0 p2 P 0 q 00V:0(0Q*  0S$P0S (00S(0Sr Q 0  <Ѝ(,g 4PI 0S 01S"0S( 0  cd 0Q('0 I00pW   0Sp00t (P P (Op(((p@0( @hd`mTQ 4 a_b_b_b`b_b^b^b`Mbd_b0- 0P@< 8 4$$4  0#1 !"!0/80? "H$ $H$ & $& < <LL`$d$h$l$/N- M0 000S@ `CPTЍ 0 00S S  @ PpP[ P P@P TPHH PL@ P<8  0S- 080P `P  Ћ  P 0(00 00, $0់ | R  (0kd080`L H@<<H`b b haaa$axaDa`dYb$`bbp@-@P`UT8`pTU l0S0C HZ`c`p88=p,$pp'`bbP`bp`bp@-@P`ӊUT8 T1U) 0S 0C 83ZP0 S 0C  00p000pTT| pH@w p8 (q p$ k p'`bb`b`b`bp@-0PD@S 0R0#R hhP, 0 " D0p 4,AAp' abb\abA-0Pp8`<@  RLL0|  FH$ 0RpX R D00S 00abbab@A-<`0 08P0H 0, 0H@, R @ 0@ @0D01`DdDh4 8l4p"| " 80C8P2rB220022 0   0 S@`0DD<4<40<4D0417807D<$D0( (<$D 606$8N-`Q@P `VpW >; U0>00 0  0@P 0UW !  `Vp0b  Pd@UT0b TWVVU 0T -P @0p)`$   + (뼃%2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-0123456789ABCDEF0123456789abcdef #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     \b,\bL+b8\bD\bT\b`\bt\b\bL+bkirkwood_egiga_initializesmi_reg_writesmi_reg_readkwgbe_recvkwgbe_send### ERROR ### Please RESET the board ### DRAM: %s baudrateNAND: ipaddrloadaddrbootfileNet: pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%coff IRQs %s FIQs %s Mode %s%s Resetting CPU ... interrupt request fast interrupt request not used data abort prefetch abort software interrupt undefined instruction USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32unknownethactethrotateno%pMethaddreth%daddrNo ethernet found. ethprime, [PRIME] Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM none%d.%d.%d.%d## Warning: gatewayip needed but not set netretryonce ARP Retry count exceeded; starting again gatewayipnetmaskserveripnvlanvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) %lXfilesizefileaddrbad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to %pI4 /nfsroot/%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *Timeout / *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail RARP broadcast %d autoloadNFS Retry count exceeded; starting again octettimeout%lublksize%c%d%cFile too largeFile has bad magictftpblocksize%02lX%02lX%02lX%02lX.imgTFTP from server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Loading: *T blksize %lu MB received TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Starting again BOOTP broadcast %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 DHCP: INVALID STATE nand%d%u MiB nand_resume() called for a chip which is not in suspended state multi_erase_cmd on '%s' tsize=0x%08llx No oob scheme defined for oobsize %d No ECC functions supplied, Hardware ECC not possible BUG: failure at %s:%d/%s()! nand_base.cBUG!%d byte HW ECC not possible on %d byte page size, fallback to SW ECC NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters nand_write: Attempt to write not page aligned data nand_do_write_ops: Device is write protected nand_erase_nand: attempt to erase a bad block at page 0x%08x Timeout!%s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! create_bbt(): chipnr (%d) > available chips (%d) failed to read OOB from 0x%lx Bad block table not found for chip %d Bad block table found at page %d, version 0x%02X nand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%08x nand_read_bbt: Bad block at 0x%08x No space left to write bad block table nand_bbt: Error reading block for writing the bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%08x, version 0x%02X nand_bbt: Error while writing bad block table %d nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Can't scan flash and build the RAM-based BBT nand_bbt: Out of memory Bad block table at page %d, version 0x%02X NAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitAND 128MiB 3,3V 8-bitToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMDUnknown%-12s= 0x%08lX arch_numberenv_tboot_paramsDRAM bank-> start-> size(not set)%-12s= %s ip_addr = %pI4 baudrate = %d bps bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsresetPerform RESET of the CPU## Transferring control to RTEMS (at address %08lx) ... bootargs## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! bootcmd XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Trying to execute a command out of order cmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartERROR: booting os '%s' (%d) is not supported loadosbdtcmdlineprepbootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image bdt - OS specific bd_t processing cmdline - OS specific command line processing/setup prep - OS specific prep before relocation or go go - start OSboot default, i.e., run 'bootcmd'bootdiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)List of available devices: %-8s %08x %c%c%c %s coninfoprint console devices and informationUnknown operator '%s' Invalid data width specifier -lt<-gt>-eq==-ne!=<>-ge>=-le<=itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2## Total Size = 0x%08x = %d Bytes %X## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'loadbload binary file over serial line (kermit mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (ymodem mode)CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) without errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) bytehalfwordTotal of %ld %s%s were the same %08lx: %08x %04x %02x ? mdmemory display[.b, .w, .l] address [# of objects]mmmemory modify (auto-incrementing address)[.b, .w, .l] addressnmmemory modify (constant address)mwmemory write (fill)[.b, .w, .l] address value [count]cpmemory copy[.b, .w, .l] source target countcmpmemory compare[.b, .w, .l] addr1 addr2 countcrc32checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]baseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'loopinfinite loop on address range[.b, .w, .l] address number_of_objectsmtestsimple RAM read/write test[start [end [pattern [iterations]]]]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)noronenandinvalid partition number %d for device %s%d (%s) mtddevnummtddevname%ug%um%uk%u%s%d,%dpartitioncannot add second partition at offset 0 incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition %s: offset %08x beyond flash size %08x %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%dPartition %s not found on device %s! %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect partition size too small (%lx) no closing ) found in partition name empty partition name rono partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08lx@0x%08lxno partitions for device %s%d (%s) unexpected character '%c' at the end of device invalid mtd device '%.*s' Device %s not found! mtdidsmtdpartsnand0=orion_nandmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts=mtdparts variable doesn't start with 'mtdparts=' device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions no partition id specified partition changed to %s%d,%d defaultdelall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08x 0x%08x %d no partitions defined active partition: %s%d,%d - (%s) 0x%08x @ 0x%08x could not get current partition info defaults: mtdids : %s mtdparts: %s mtdparts=orion_nand:512K(u-boot),512K(u-boot-env),3M(kernel),-(root)addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, reseting to null delcurrent partition deleted, resetting current to 0 partition %s not found chpartchange active partitionpart-id - change active partition (e.g. part-id = nand0,1)define flash/nand partitions - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)Device %d: %dx %s, sector size %u KiB .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error ** Unknown image type yesAutomatic boot of image at addr 0x%08lx ... No memory for page buffer Error (%d) reading page %08lx Page %08lx dump: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x OOB: %02x %02x %02x %02x %02x %02x %02x %02x Not a NAND device bootdevice ** No boot device ** ** Device %d not available not a NAND device device %d whole chip offset 0x%lx, size 0x%zx '%s' is not a number quietinfono devices available No such device Device %d: %s... is now current device erasedumpreadwritescrubmarkbadbiterrlockunlock no devices available Device %d bad blocks: %08lx clean NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted OKERROR.oobWarning: padding size 0x%x to NAND writesizeUnknown nand command suffix '%s'. written %zu bytes %s: %s block 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad NAND sub-systeminfo - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand erase [clean] [off size] - erase 'size' bytes from offset 'off' (entire device if not specified) nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub - really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]ping failed; host %s is not alive host %s is alive hostnamerootpathdnsipdomainAutomatic boot of image at addr 0x%08lX ... bootpboot image via network using BOOTP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocolrarpbootboot image via network using RARP/TFTP protocoldhcpboot image via network using DHCP/TFTP protocolnfsboot image via network using NFS protocolpingsend ICMP ECHO_REQUEST to network hostpingAddressSaving Environment to %s... ## Error: illegal character '=' in variable name "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted setenv Environment size: %d/%ld bytes ## Error: "%s" not defined saveenvsave environment variables to persistent storageprintenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx ### WARNING ### "autoscr" is deprecated, use "source" instead ### sourcerun script from memory[addr] - run script starting at addr - A valid image header must be presentautoscrDEPRECATED - use "source" command instead## Copying part %d from legacy image at %08lx ... Wrong Compression Type for %s command Bad Image Part Invalid image type for imxtract %8lximxtractextract a part of a multi-imageaddr part [dest] - extract from legacy image at and copy to %s - %s Usage: %s - No additional help available. %s %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands TK71>> ... versionprint monitor versionechoecho args to console[args..] - echo args to console; \c suppresses newlinehelpprint online help[command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments.?alias for 'help'In: No input devices available! Out: No output devices available! Err: No error devices available! *** Warning - bad CRC, using default environment *** Warning - bad CRC or NAND, using default environment Erasing Nand... Writing to Nand... FAILED! done NANDUnknown OSUnknown ArchitectureUnknown ImageUnknown CompressionCPU%d Bytes = bootm_sizebootm_low%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx -## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... uncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedInvalid ImagefilesystemFilesystem ImagefirmwareFirmwarekernelKernel ImagemultiMulti-File ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone Programflat_dtFlat Device TreekwbimageKirkwood Boot ImageInvalid ARCHalphaAlphaarmARMx86Intel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 BitniosNIOSnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32Invalid OSlinuxLinuxnetbsdNetBSDrtemsRTEMSu-bootU-Boot** Too many args (max. %d) ** ## Command too long! Unknown command '%s' - try 'help' 'bootd' recursion detected %.*s prebootbootdelayHit any key to stop autoboot: %2d %2d MII devices: '%s' Current device: '%s' NULL device name! No such device: %s PHY duplexPHY AN duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T PHY reset timed out miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' serialUnknown errorCksumCRCxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Block sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file88E1118 Initializing on %s Err..%s could not read PHY dev address @%02x done egiga0eth1addr%2ld.%ld %cB%s1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header ERROR: Failed to allocate 0x%lx bytes below 0x%lx. (null)invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionsysrstdelaysysrstcmd88F6281_A0SoC: Unsupported Kirkwood 88F6192_A0SoC: Kirkwood %s machidUsing machid 0x%x from environment Starting kernel ... resetting ... U-Boot BUG at %s:%d! mtdcore.cRemoving MTD device #%d (%s) with use count %d Attempt to read outside the flash area NAND read from offset %llx failed %d Skipping bad block 0x%08llx Attempt to write non page aligned data Attempt to write outside the flash area NAND write to offset %llx failed %d Skip bad block 0x%08llx Warning: Erase size 0x%08lx smaller than one erase block 0x%08x Erasing 0x%08x instead Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure @0x%08lx: %d tsize=0x%08llx %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Err.. %s Failed to allocate memory egiga%dErr..(%s) Invalid phy address Err..(%s) Invalid register offset Err..(%s) SMI busy timeout Err..(%s) Invalid PHY address %d Err..(%s) Invalid register offset %d Err..(%s) SMI read ready timeout Err..(%s) Dropping packet spread on multiple descriptors Err..(%s) Dropping packet with errors Non-aligned data too large (%d) Err..(%s) in xmit packet raise: Signal # %d caught a0taa?&0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N Xhb \hb `hb@hhb@hhb@hhbhhbBbt01tbBqqb3@bs@bC@bS@(b5 @@bu @XbE @pbU @b6@@bv@@bF@@bV@@bx@b9@by@br@bI@0bt@0bY@Hbq@b@b@b@b@bbb0b`bHbxbbbbbbb b8bPbhbbbbb@bbbbb bb, b(b,bx"bL+bL+b"bL+bL+b"b L+bL+b"bL+bL+b"b@L+bL+b<bL+bL+b`a`&b&b&b&b&b&b&b&b&b'b'b'b 'b@xnbxnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbnbobobobobobobobob ob ob(ob(ob0ob0ob8ob8ob@ob@obHobHobPobPobXobXob`ob`obhobhobpobpobxobxobobobobobobobobobobobobobobobobobobobobobobobobobobobobobobobobobpbpbpbpbpbpbpbpb pb pb(pb(pb0pb0pb8pb8pb@pb@pbHpbHpbPpbPpbXpbXpb`pb`pbhpbhpbppbppbxpbxpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbpbqbqbqbqbqbqbqbqb qb qb(qb(qb0qb0qb8qb8qb@qb@qbHqbHqbPqbPqbXqbXqb`qb`qbhqbhqbpqbpqbxqbxqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbqbrbrbrbrbrbrbrbrb rb rb(rb(rb0rb0rb8rb8rb@rb@rbHrbHrbPrbPrbXrbXrb`rb`rbhrbhrbprbprbbootcmd=nand read 0x800000 kernel 0x400000; bootm;bootdelay=3baudrate=115200preboot=echo;echo Welcome to TK71 ;echo;echo by kernel concepts ;echo http://www.mucross.com ;echo http://www.warpcomm.org ;echoupdate_uboot=dhcp u-boot.kwb; nand erase u-boot; nand write ${fileaddr} u-boot ${filesize}update_kernel=dhcp uImage-tk71; nand erase kernel; nand write ${fileaddr} kernel ${filesize} update_rootfs=dhcp rootfs-tk71; nand erase root; nand write ${fileaddr} root ${filesize}update_all=run update_uboot; run update_kernel; run update_rootfs; resetmtdids=nand0=orion_nandmtdparts=mtdparts=orion_nand:512K(u-boot),512K(u-boot-env),3M(kernel),-(root)bootargs=console=ttyS0,115200 mtdparts=orion_nand:512K(u-boot),512K(u-boot-env),3M(kernel),-(root) rootfstype=jffs2 root=/dev/mtdblock3 rwQbUbUbUbUbUbUbUbUbUbL+bL+b\TblTbtTb|TbTbTbTbTbTb TbTbTbTbTbTbTbTb TbTbUbUbUbUb UbUb$Ub,Ub 8Ub.3m.../2.5*+v. Jv. Jv. .vJ Jv. .2*++ f J0--&./0J}J+.U.+JUJ+.X.+0).6Oga.OE~.N0-/-/-/-/1-$JNijx.x.u. xi0,/J-,-/Kgpg#.j/w.w..}/(f:J,/,~"K%.,0 ~.0,/H0ggg.j*2H///I/-0g~J3.~.0,0/.ge/-~t0gb.hg& /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/byteordernfs.ccommon.htypes.htypes.hnet.hnfs.hswab.hbootp.h4&`.1KK)Rz./.J3gJq./ .NL,LH0,0+K0,/0+//K/g/-0,//1/1J1NX3pJ&0 Xf3h:0 ./uf#j/e/LOJ3h X/vJ'e/LOf3h:0 ./vf#j}J5y.54z./10)10)1+10,u.63s.6101z.--/0//z.1P3,0؄K00rft4I/-KzJ4-H0/2+1a0/)KP/mJ41+1LIK=m)3)3 Ej! J41+1LH00-g=f4z.40HL0/-/-/-/-4)-/3*H/3lhH5)3<nJJk1Jn1.q.t1 .w1lz .u. .w. .w./+,00/6/hfK4y.{.LJ1N,jgL3My.5yJ-61IM.hKL,0fgf~4-/KhzJf4h:0.1lf#j0,,00gKI/glzJ4Ltg#+ Jw|.|..|.kf.1gJ|Jy#31KJc.N.J.2J.2g-4=JD.3KfK-/KNk[f+JV..K-{.J{..,.j.c.K KH(J[..s.2 Jx.w /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/linuxrarp.ccommon.htypes.hnet.h6`)3/-03+/0wJ2/MH/0Kg/-X1n-/z.* f-/ji,*P) \ /disk/u-boot-kc-n/include/linux/byteorder/disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linuxtftp.cswab.hcommon.htypes.htypes.hnet.hbootp.h(8`o.JLdL/-1H0PkJ/-1H0Mr.-/-~.MS./-0gK-KM-hPzP JK^.2*2-/-K-//H0.0Hh2*0hggLL/0H-1/M-N,I1 J+v. Js. s. .0 JI.hNKI/KfkfU6-/Ki,x. Jz.~3)3f~JPG~.,Mx.6.j, .u./1,/6.I0/I-0}..~.`. .K. . fK~5z.-50,e/K~J.-QG.Se/-0-/,0 fJg.. /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/byteorderbootp.cnet.hcommon.htypes.htypes.hbootp.hswab.h?` .g//0/o..*4,1KvJ6x./M,0/g0Kg/-/0,h1,0,M+00*0,10,////+///1M,0HM+N*10,////+///.+fWJ%.2W.%.2eKI34.-..A.?.Af?.// 003j. .3,/0/~J~..~䃆 w  .g~..x./~J0H0c4/-/2g{.-/ji,*P)5y.5y.K4!.,./-.-/{g>JJ}J}} L/-K-/}J}g/{.JyJyf0JyJ+hh.}..}f.}.\f|.-/-/MGgJ|f|}f.}hh,h gf/I/1n /z./X.|.f|...f//+z.12-0//}.}..}.}z0,0HLl/fx.gy.0X /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/mtd/disk/u-boot-kc-n/includenand.ctypes.hposix_types.htypes.hu-boot.hglobal_data.hmtd-abi.hmtd.hbbm.hnand.hnand.hK`c.0,1-,0/f/ .1+K Jx.^. .v.1H05wf050-/  /disk/u-boot-kc-n/include/linux/mtd/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/asmnand_base.cmtd.hbitops.htypes.hposix_types.htypes.hmtd-abi.hbbm.hnand.herr.h L`0 .g .g Jg".*00KIK-0 J,0Ke *00/WFJ0*2g-/-/-J0z.02g-/-/-0 J0z.02/WK-OEJ03,E30 .ggKKj2KMwJn.|J+1,-1gf.K J/-1,/,0,O00L󝽟e/I12/0,0,)5y. f f .w.4z.4z. .w. .+zJ410,0nx.2s. .N21/-/-/gaf.a./-K--fdLSJ2fN.2JN.2.d0K+1//-/-/0,0,0y. jfxJk(+J .y.,K/100׃e/I12/0,0,)5y. ffh,0, .vJ/00/2Ke/Iy6/0,0,w. .u.f f1+5y.//10 s.)/0,0,02jfMgfh..h.f/KJ-.K/ JG1+2-+1+6a+//4Kuf/-Kvz.4Pz.3u.1gnK f0/+k fIKI/ .v.-1-,0K/5llff.&J/-Km-l.Lj+1+1Ki,nqK.K .1+ .w.g/001ם J1+/Qz.,L000g J1+5y.//10 r..,0r.Lgnp..p.f/K./1F2K.s f*.s fJ/ .Kg/-{.00}J.0,0I/0׻J0,2j3)O)3. .t./PKKKL< fKg/K3)/K1+/LLMMKKKKKKKKJK-/I4gI/gK4z.4z.4/gH J1+4z.11iMJpJMKKKy.5/x.6 .w.K6x./Ry.tJ/4/ .M~.K-/*fJ=LkmKKKKK+fLK1+/L-0,0/).*L@  Kt.J!fvfL[ K3K*K$.kb+/0n,z./-1+1+M3jKIx./-/M+1KJiK+jR.K1{.f1GMLi )3[J/+1+K0!`J- .dJ/1 -ipJ>K/-2/ey.03/x.R3G1sJ. .6./OfQ N x6Mq../LI/L1LW.~f1+ .-x.2*0,6*/2NfJK/-/-/i3+1+i+,/2/gMgv(jJ)3~ iNQ,2K/-KgC-/-0,0EJg.-Kd0KGity.5y.2G46uJ J JMiLfJ<~.3)3*2LfvJ JK,00hH2MnJy-/-g!`J- .dJ/1 -ipJ>K/-2/ey-0,0Oy.5-/-0gf/1+MJ}..}.2,/,0/+3 f0, .v .v. J. .~JmlJt. .t. .-K11++1MG1M 2*hJ.O)5,0.f L J2fQoJgj*1K-/PVc/-KgK-LJhJKgJ/u.,0, Jy. .1lz.3g fgv.wlz./gv.}J./11g .u.. fw. .y.Q0z.4w. f-)*1/1v. .O+3,G/00/E3jF4,hKjg/,0Ji fR,2 J~2bj:J3)O./-/-L,0Qif/-K .)փKdgJy.5y.2*.2*/46y..y.. JMLff1+10)+1+ fKgI,1/|J0,,2,,/1/,2~J.~..~..~.~.~.f~.+K/-gJ1+p..1".M++1HJ-KIKK/ge/K.fdhJM/-31x.6xJ40*J[fhR+i/-/5yJ- ./,LiPKu.jfg~Jz.4z..K3/Qz.4z.l".[JXk.pJ.pJ%JkJ0L,K//h-/v J`. .`.///jI//--0K+2F4z. .k(5y. JK/K1+3KiUJg .gKg w.f J/{ff/-/KfAJLLN XKOLLZ-/g0I00I-0g.Kgu.KgQ.g3{K-5yJK-5sJ ffY.'f@J gL-/-K/j.gj/gB.gP.0փz. J4z.PK`tfg fu. J1+11K0Lf~f JgK fh.K ~I<SJ,g~.kg-..~..~JhHL ~J~.fKO*K/0/ JI6gDfgt.LLMcMcNbOaOaf-MgI/L,LhJf#1G10KK~2//r.//s.//t.//t.// /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/byteordercmd_nvedit.ccommon.htypes.htypes.hu-boot.henvironment.hcommand.hglobal_data.hnet.hswab.h a0f.LGGF5y.-/-t./+1qJ.m.f+1h/I .w.O-/-*2rJ}f5y..O00M0~fh"Pz.44z.4ie/-/I1%0/ f15k1L,0-MGlD.K.  J K-/Dփw.:/0 .fP..i+1/IO0KO/L)&-/3g-*3hJ/-//-K1G}5y..5, .u.0Oz.Pz.-K-4z.40PlffmfgG JLMmf*.N5N/d0Kc2* .nJgh y /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/linux/byteorder/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linuxcmd_source.cimage.hswab.htypes.htypes.hcommand.hHa/..h0fJ}.!JJJ}f.k xJR4.g.!K0igx.K.g1K.K.g z.4 JgL,J./-g0-i /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/byteordercmd_ximg.cimage.htypes.htypes.hcommand.hswab.hcommon.ha%K-..p./.0,0/,0/E3/}.!fIJg.g}fKKMKO6Ng.v.g.go.4g.*0G /disk/u-boot-kc-n/includecommand.ccommand.h$a.M/zt+.M/jH2)}N*/1 JMHLJ./hk/ix.g}0hF2kK*QzJ. .u. Je,MNF JEnJ4x.K1FK1FK1~fN*2,.pJ,h,/F2*2* JIf+fZ.)OK-K-3-1/K/y.5y. .tJfo.JPLxfg-/12F2*F/I/I./g-K .v./ Jf1JQzJ/I4E3Jq.P+1+1?qJ.n.LJ.KK JP.kgK; Ju.H<Jg flz.R/wJgKPz./LKJ 3E3/1G4"KMO_JJg~...00eNE3)Qa;J/KM,0/-/KIK/KL/-/1/]fK~.f0/-/0fJK~pJ /disk/u-boot-kc-n/include/linux/opt/mucross/arm/lib/gcc/arm-mucross-linux-gnueabi/4.4.2/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/includeconsole.ctypes.hstdarg.hu-boot.hglobal_data.hlist.hstdio_dev.hexports.hT"a31+11Og0O4z.4l/K,K/ q./IK/f-/NJM-/JM-./.-./.L0i0ig$J//JRNJ.1L130K1+1~J f)3v. .a32g: u. .Q+3 .f5+1/cf f)O}32K2-KiiKiiKiM+p.OKgOKg3) 1.#,3iGPkKgnKlj J| f)O}31K u. .Q+3 c.m*3 h.m*3 ./5u.gLHK /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/includedlmalloc.cposix_types.htypes.hu-boot.hglobal_data.hmalloc.h'a I3MQM,0O/z.M0) fx.6gtJMM .f2sJM+ .tf0 t. .2/L/-K fg{f t. .1/.*/1,0,0.*2 J, .u.j0,///4dJ2+1,01izJ4fPF,00/0I/O,0,///&JZ.".y.R-y. fXy.p..0J!L uJhK0L .4K0 J,L0L,L.PK1Q/-0I/-/-1-J0+//L--NVJ~,5|..y.5y.R|,0+1|..o..01)3)3+51d020/5{.{.0+1{..L2b4z.00,250d6-KK3)-1,33KKgI/I/. f0~.IK-/-1%J`O .oJhK0N*2I1*0I0L--N"../,K/0~J/0 .w.J-0,01+0,/JHR4-)5ji+0,cfK+1IKLF.~#JJ/}. u.. .2f..0.2*jgLNH0J2*jJ-K0,KRh JyJ/K/-g%Jo.//.N/PzJ0H20. lq.} w.. .1,00,0JfJN .m..10+M+t-3+1,-2-Jf...ML2G1+1fg..f4-/  JL3)/N1JK- JNFN~J. f/-Kj/qJ00,/-///-KJ.h..LN~f.J3)3I/-0,0gQJ.~..jFNH-/I0,0g.LPRK,Mf-k /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linuxenv_common.ccommon.htypes.htypes.hu-boot.henvironment.hglobal_data.h:ag0,00Jg0,00mJb2s.K0,0cJj)JU.J3)3.g.Jg.Qhg0,0.g/-4shrf/-/d0j. J~f-/f4/K.j*2 J0ks.KL3k /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/mtdenv_nand.cnand.hcommon.htypes.hposix_types.htypes.hu-boot.henvironment.hglobal_data.hmtd-abi.hmtd.hQ0G4VJk.LJM[f).Ufj..0JJf+1,/{/m..Mi+0,L,3hjf+i1|JmL| .t. .ij,M :0,0,0 fLj.(.X.(JJ .~J+.U.+JOO2*gI/K4z.4z.0z.2JgM.fO f  fvJ .0H0H0,N[fg~f,0d0/-HL-K4-0,0-zJG1.g~.g=-KKdh--K/#fg-/I~fgg/-/KgJKj-/-//-Lggg-/,0NYKj-/-//-Lggg-/,0OI~f. fzJ//-/Kr.g-/I}fRK/LKKg-L0,/@N,0-/0i-/-bJ-//K$K-/~fgKKP{J-//g g/-/Kb..L!gdh--//ffkfK-/K/-K0;OL2,0Mjg0,/-/-0/|..dM/-0,0G3-/I/-h0H/0QenJ^.K,0I-/G//M~JK}JIKJ-/-}JN2*/KI1K,L<#J~J e/-0/-HL,N,/-05OO/I~J ~J/-/J/-/3K}./-/K4.w"%hG/K+1./-K/~.X-/-JL,1-/Li-/-~K.~-K4-K/f/-/K~.KKL,1-/fkK+1+/0O0,/K"4zJ//-/K}.K./-/K.!./-/K./I/g|.//-/K/-+2K.~!}J/-/K./-/K}.L,0+M./-/Kf./-/K-./-/K./-/Kr /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/asm/archdram.ctypes.hcpu.ha!L+1hlL,0/0 /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/asm/arch/disk/u-boot-kc-n/include/linuxcpu.ccache.hcpu.hsystem.htypes.hu-boot.htypes.hDa!0,h&0/,/-.gJ.l.-fgKihgN+1X.%.[.-)fL,/N+1Q.,.T.-0fL,/N+1J.3.M.-7fihigMzKKKKK///KKLf +iw. .}JL6 .u..s./ ..q.//// .*/0[J~J./g~.0s./g~.0s.0hg}.0}../}.LKNi4z.45~fLR.+1gLh~ u. .u. .LH0eMv E /disk/u-boot-kc-n/include/asmmpp.ctypes.h$a q.q../.W NK/-JpJRvJOOR-/HLp,06vJJ/ r /disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/asmtimer.ctypes.htypes.h4a-/-0h,0,h3+1G1+1+111j-/-..//MKM/-/-M1+0-i Bf>./1../.-JI /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/includebootm.ctypes.htypes.hlmb.hu-boot.himage.hglobal_data.hsetup.ha;/-5y.1211>.GJ,0/Ki?J30,/1 .KkJK.j..4z..q.O .2JF4z./0,3J./-~. J0;JLLGiL4 cache.ca /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linuxcache-cp15.csystem.htypes.htypes.haV."f^.K-(LMQ."f^.K-(LMnJJ."f^.K-(L"M."f^.K-(L'MN4J_E /disk/u-boot-kc-n/includereset.ccommand.ha*/LL/NM /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/mtd/disk/u-boot-kc-n/includemtdcore.cposix_types.htypes.htypes.hmtd-abi.hmtd.hubi_uboot.h aN J2sJKjM3)On.h2K-/fG1nPs.X+1+1ieq./-0 .q.JjgOMgN# /disk/u-boot-kc-n/include/disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/include/linux/mtd/disk/u-boot-kc-n/include/jffs2nand_util.cnand.htypes.hposix_types.htypes.hmtd-abi.hmtd.hbbm.hnand.hjffs2.ha8J3)O|.J|J.|.J,-1z./3kEwfJJ0,.4z.l0g1 f{.. J{..KL{.{J.5fJ.-e./{.OKw. .wJ Jtfg{.{J.003y.5yf.m4L f|.. J|..KL|.QfJ.-e./|.OKw. .wJ JRf/g .g[.|Krg|J .t.62b00/ .r./3K5y./wJ/0 .K12)3)/2/LMR&_ggK;f.-/-K-.i0/-/jJ6Qh-+1'i]1+//0L*2K .U^.hgJLD /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linux/disk/u-boot-kc-n/includekirkwood_egiga.ctypes.hu-boot.htypes.hnet.hkirkwood_egiga.h4a3/-/I2/V..n..KK.J1}JL,00R0rJLLR0J6x.L .t.P///1.3)3*?J0C.,fxJ*j1ielh f1I///KK/-/xJG/-0-/1Mj]he.LLLL{.g5E5H5N J-/NNh11q.q.1.g5E35O J-/NMk5g-/OOlH..._.y..r.04)3J0jfK0,+OMg.L XHx..h/3/PK4P-/3v. .v. .0Px.Lz. .].m.q..q.,1.p./3w.6*2x.2-/g+5w.0/0dQJ+/00~JgYJ .x./.P,. fu.2220,0,0.0z.0F0,.k,//0*.V.MKKL1 .v.m10J r /disk/u-boot-kc-n/include/asm/disk/u-boot-kc-n/include/linuxdiv64.ctypes.htypes.ha/-6x.0PgL-/-/MKH{KMKHFKL0pJ*ao /disk/u-boot-kc-n/include/u-boot/disk/u-boot-kc-n/include/asmmd5.cmd5.htypes.ha6F2!-/wJ .-/I/-///-/-/I/-/g-/I/-/I/,0g-/I/-//-K-/I/-/-/-/-/-/-/-/I/!!!!!!!!!!!!H0gIKI/I/I/K-K-K-KI/g-/-K-KI/g-/-KI/L,-K-K,0-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/-/I/I/I/I/,1,-///G//0~).4g-/1+/4r.RP1/+M2/-/h.f.1Jh-3MH`f.:Jaf)g- .)3Rs. .-5p. .P0/-/l..Jic..JKLg\..Jg-u.~.~J/~./..~f+/M-.1G1/V~.~J/~./.2~f+/M-./I// : cpu.ca&62/ .yJ;$ eabi_compat.caKL /disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/armlib1funcs.asma//////}.)/0//0L/2{f.///// /disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/armlib1funcs.asma///////////|.)//0//0///0L///2yf.///// /disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/armlib1funcs.asma////// /disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/armlib1funcs.asma//y.J`x`start.S/disk/u-boot-kc-n/cpu/arm926ejsGNU AS 2.20)-K`` PSintUKtE\,. 1(/{# 80{# ' (H# ),# *# 9+{# ,{# 1#  * d2* $$bd%5# f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7;H"7[``]]``])_``]a``]Rc``]e``]4g``]&i``]]k``]``]H``iH8{H`` yH`d`>#tmp{#i|H t3 d?bd``jhl hs nnp>{}bH{!{"{ t djgd<X t d2Ia n d y ab_-`(` PSintUKH)*#gd T``] xXH``] e`` mTe f4g,h~u''d-n_`,`  ,`P`#p B 'P`t``  t``  ``  `` 6 b``T= s`(` ^-(` `2 0 PSintUKu80E\7 . 1(/# 80# '# (S# )7# *)# 9+# ,# 1/# # ?y2?%Yu B8_ `# 2a# bS# +cS# \#eI# ]fp#$ [g#( \h#, EClC#0 3m#4 y 0.ySCCJu.SiCiSoOSCvC %y;S oMS S #GS(`0`]@bisGJ^C0`@`]wC@``]ZwSdevyC yC>idxzSRcS``]devC\numS a`( `!kS( `\ `<",ki"=FkS #sS\ ` `>$ ` `]%cC ` `]Pc|deveCTeC&u ` `'act}b(S}b)mC)o6S!&S `H `Jq"Si(C}b*g+,act%`SH ` `devCdC+-act%q0S ` `$0O20mbuf2\ % !y.( `d `r r2Pend di!STx%.*Sd ` `*2*P//x ` `-0 1x `| `0%y9S ` `M.Z9Sx29P2;.P >y!)9S ` `3bis9J);S)m<C4dev<CO+8(5G`%S ` `b1bisJ25XS+PdevC؃+h-act2D\C}b28\C}b5XdS-5 `4&`2 0 PSk>intfpUKu16"> Z>> [pE\7 . 1(/# 80# 'P (^# )7# *V# 9+# ,# 1\# P l2l $$bd%w# f4&7# &,'7# (7# )7# *7# +7# V,7#jt6# 7} HP-HHppp%X UYa  Q# # # %# [%# g %# %# %# %# # % b a P# # z# # #z  9 %# %# # §# ç#  %# %# Ƨ# # 0# `ɧ# cʧ# 7 ˧# ̧#l ݡ Iާ# # %# ` %# # F# % D id #~ #  #mtu# 8@8 (rBI%#%##un #" 8glARP  DNSNFSCDP2 { g ? ) pG ptrH len^!"pG#C cSh$xcS#pe$xpe% ip&! 9^'o  to ip( Y fY") **# `4`]+% )4`8`]w,pkt)HP-T)pQ,src)pR,len)pS.8`H`]/P0M ^H``]1ptrH ,len^Q2H``3$34H``50# 6<.``]276 /$Q50T 6<8 6`X`]w,dst6P1src6g -86^R9W{X`` 1s{ "id}9 `` 1var 9 Y`4` f 1sY@ : [t ;e\d;i]^T<``O ;valcP2h`,`k3y9 4`D` 1var 0^D``] :  2ML`X`3^8 n``]# 1xn 1sn 2M``p3^=n O`4` p 1xOI 1sOg 2h``Q3y>wIp4`P`z =a `P`` 1iv` 1f` N' to[&. ``] 7 7 9=^`P` 1xet . ? HL ?j "et :  @M`` 3^4``"vet   A%a8 mP`T`] 1pktm 1lenm^ BC T`d` z Ci^Dpkt֮  Carpz E``[ /v|3F`7 3Gd``4 =.`l`S :Y0r !} 1^: 1^ 2<`H`I3B l``  Dt %N C &["ipH `` 1pktH?Tp)1srcp<1lenpO"tmp"ip 2 ``3+ 4``I7 l A9=`L`b1xip ?T?q^?^1len^"ipJ `-{3 3 J `.3 3 2 `4`3334 `4`I0R6<9s^L``&K? sHQ?Tso?qs^?s^1lens^KpktuH 9 ^```)};mac~b"ip "s}KpktHHJ `3 3 JM`3^@ T`d`3 3 @h``/334h``50q6<@M``I3^2``334``506<A' &: !^"bdw!o6^%5^&: L#M"num^93^```H?: 3Kbd5wL NT"iE^J`Ho3OP`O5 @``m34``I}53Itb2 4`H`3 3 <``Kx \< ``` ;buf HL2 ``2``3 X= `4&`o? 1len^"et Kip "arpz Ktmp+Kx^I"pkt H"cti :#  :  :  JM`(83^JM`%R3^<!`h!`l"vet> J !`83+ OP57 P@M!` "`3^@ 8"`H"`3+ 48"`H"`57 J x#`h3+ O57 @#`#` 3334#`#`6O:7@$%`L%`8334$%`L%`50+6<QT%`<33O50>6<R ^}bR^}bR}bR }bR½}bRý}bS"~bTHUw}bUv}bU xb U<|qbUL}qbU ~ԢbUbU|bU}bU bUN}bUxbU)Į }b EU? 5DbUh bU^bUX p~bUbbU~bUbbUtbbU^}bUX^}bUbUs ~bT =^T &^VgdeDXJA  %`WUr$~bAOU` }bU }bU* H~bUH~bU^~b %WUTbUL н}bU^}b} } - 4&`6` 2 0 P  0SintfpUK Z>E\7J jLh le H%% 7c id8# BI9# :#  ;# <# =# -@>c#s d@ idA# BIB#  C# D# v2E# 7 F# -@G# 5 -@6 ? Hs(4B uI#R?bpe}xpes sc s u C^srcC\CplenCp E c4&`&`Qc cp eK t&`t'`tpthl^8? ^K{ } ^t'`L(`^ ^pktlenp (oY ^L(`(`&pktlenp (oq ^(`)`8tpktdlenpw (o ^)`8*`pktlenp (o 8*``+`W ^8 ^V-@Wi ^pkt(o id7 pW ^^`+`+` ^ver^-@գ +`,`(c T-@_pWr len^ ^" ,`,`a-@_!pW!len^" /,`-` /-@1_#p2W!len3^$ 4^!" K-`H.`4%\K^mlK^-@M_!pNW!lenO^" H.`.`e-@_!pW!len^% d.`(/`]& (/`d1`'}/`/`()/`/`* +0`40`,R ,i -#p . <d1`1`I7 ^1`2`hpktlenp (o$uK^)`2`2`, ^ ^2`l4` pkt4lenp] (o$uK^p/3`1(((- *"Hl4`6` pktHTHpAsrcHplenHp$uKJ^/}5`H(-`0 &^b '7b, (^bb )^b + b, ȣb .^b /b 0^b 1^b 2^b 3^Db 4^b& =Bb >b_ ?b  @ b1H2<2=2E2G2 I2NJ2K2)LZ ` 3%2]^1E\7 H%%o  Iކ# # %# ` %# # F#%) o  nX6`7`'q iZSpkt[qFV\|w%)J07`7`d.050Z<0ZC0Zs2y[K7`(8`HNJ)LqQ]S *SHbi-(8`?`2 0 PSk>intUK Z>E\7 H%%zz C cS xcS 8 e src lene \ (8`9` pkt7xplen^s8`8`%9`t<` epxp;`;`R "i #t<`<`*<`?`IpkttTesrcelene1 e si^ $=`4=`* >` !"! ", # #(bb#S$^,bb#2Ԭb#{3^جb#4^ܬb#5^b#z6Ьb#7b#8b#g9b#:^Lbz #& Jb#RPb#c>4bb#d> bb$H%<%=%E%G% I%NJ%K%)L%]^$<&(/$bb&<0^0bbL v-?`K`2 0 PSk>intfpUKu80 Z>E\7 H% k Qk# k# # %# [%# g %# %# %# %# # %{ $X 3%#  %# "%# {$%# %# &# '# (# )# *# q+# ,X# -h#, .x#l i/# %h  x ?   7w0{JOYQ^9^^!LtoLLpemxpeC cSxcSK^pktKTKpsrcKplenKpbpMN^@^0o +toipg^?`A` eg)!\g^"Fg"Pg>"1(i cntj!@`@`"tmp^\"#A`\A`"tmp^z"$!A`C`""pkt#"# bp$%%^"& %^Y%^'PB`}p()*z|'xB`~()0*} 'B`P()p*} 'B`()*} +& C`(?(4 ,%-C`C`].XC`D`"^to/,D`4G`#>#bp\#0endV%^#%8^#'lE`(((18E`E`(Q(F18E`E`&(Q(F18E`E`E(Q(F18F`F`d(Q(F'F`(((1&hF`|F`(?(4+|F`(((bL l_n pkt bp  !^!^?!^"2kbpk m/[4G`K`#" pkt[ $T[pW$src[pj$len[p}$ bp]'4G` bC (((()@334G``_()5$1G`@H` 6$7G`G`(#G`G`5%8J "sV%'_lH` (l)5vt%98H`H`q (Q(F:8lH`o (Q(F;8J`J`s(Q(F7LH`\H`(#LH`\H`5%'8I`zs ()5%+\I`0~()H5 1&33#5.e&3:3F5R&'I``: ()6&1&J`J`B (?(478J`$J`I(Q(F<<<=< > \ 'b> (^b>.b>$/7 b>0b-4K` L` P  %SintfeU~Ku16"30,e1,-6S%UeV,E\,eZJ jAh lZNos.W 1(/# 80# ' (S# ),# *# 9+# ,# 1#   22W  $$nbd%# f4&,# &,',# (,# ),# *,# +,# V,,#jt6n# 07  M 1(N# =FO# P# r \s# =Ft#@H|' }# ~'# # 7# 7? G  # D# # |# 0-Amtd.# 2#len3# <4# '5# "F6#dev7# 8# 9# 3:#$ +;#( EC<#, . BIv# f4w# 8x%# ~# # # # # ZS#$ E#( S#, #0 N#4 w$#8 #< -L#@ *#D #H #L "#P #T 2L#X `#\ L#` L#d f#h #l  #p W #t 5 #x #| YP # HP # G# S# 30# \ # S# 5 # M# A   e? \A# B# C# D# ,Q  1U  j Fk #lenl# m# fn# o# p# q# r#    S Sn    SFF  "Svv | RS  S  S  S %  S5  % SP  ; m V W$ 1 4 2S# W 3 # 1 4S#  5S# 7 6 #len 7S#  8S#  9S# " :# S   S' S  b  ~Z t&4O 3   . # . ; r0#Y s0#  u#I v#  w#N x"#{ yB#Y! z_#y {' # H |P #$E }^#( 5 #, #0 #4{ _#8w 5 #<{ #@* #Dc S#H4 e#L S#P S#Tw S#X S#\ S#`! ,#dn S#hF S#l S#ps #t S#x+ S#| #N #E #ecc 4 # #G! e #ops #bbt # - # - #T - #3 0#  XH N F Z # S#8 S# S# zF S#y S# S#H # _# ' #$ #(; #, #0* #4 #8* #< ?#@" "_#D_S NS  eS S. S .  S.  S?. SS  S_. S E 0 1#E 2# 3#    S "S  SBS (^Se HeSS dS. S. SSS S. SSS  e e& #A*Smtd**. J+-Si.S !NK` L`&iPS8Qe! K`S"3"("#$>$I %$ȭb &% %'a 2%(خb'+!S8bb e'"Ub(gdX )tx4- L`` P  %SintfeU~Ku16"3u32%e0,e1,-6S%UeV,eZJ jAh lZNos> 6  M| 1(N # =FO # P # r \s # =Ft # @H| } # ~#  # # ? |  R  # D #  # | # $ 0-Lmtd.# 2 #len3 # <4 # '5# "F6#dev7# 8# 9# 3:#$ +;#( EC<#, . BIv# f4w # 8x+# ~ #  #  #  # # ZS#$ E#( S#, #0 N#4 w$ #8 '#< -W#@ *#D #H #L "#P #T 2W#X `#\ W#` W#d f#h  #l *#p W*#t @#x  #| Y[# H[#  # S# 36# g# S# @# M #L e? \A # B # C # D# ,Q 1U  j Fk#lenl# m# fn# o# p # q# r#SS?'SQQ-S]S!SES S*+S@0S[Fma W$1 42S# W3# 14S# 5S# 76 #len7S# 8S# 9S# " :# S   S2 S m ~e t&4O >   9 #  9 ; r6#Y s6#  u#I v#  w#N x-#{ yM#Y! zj #y {2 # H |[#$E }i#( @#, #0 #4{ j #8w @#<{ #@* #Dc S#H4 e#L S#P S#Tw S#X S#\ S#`! ,#dn S#hF S#l S#ps #t S#x+ S#| #N #E #ecc ? #  #G! p #ops !#bbt # 8 # 8 #T 8 #3 6# XH Y F e # S#8 S# S# zF S#y S# S#H # j # '  #$  #(;  #,  #0*  #4 %#8*  #< J#@" "j#Dj SY S   p S  S 9 S  9   S%9   SJ9 SS+Sj9 SP 0 1#E 2# 3#   S-SSM S3iSeSeSSoS9 S9 SSSS9  SSSp p w #id S# ,#! ,#   ,#4 ,# id S# #S9 mtdS" 6 fF !2  9  S &:"ptr &8/ !W"ptr !8! r # L`8L`&$mtd'%9 &8L`HL`]$mtd'%9 &HL`\L`]$mtd̒''%9 &D\L`lL`]D$mtdْ:'%9 #lL`L`M'$mtdl''buf Q'lenSR(iSS)9 T*IL`L`]+mtd',bufQ,lenSR(iSS)9 \-v SL`(M`'`+mtd ',buf  Q,len SR(i"SS.#9 *z3(M`\M`]+mtd3',buf3 Q,len3SR(i5SS.69 /p70SG\M`M`'4+mtdG (,bufGQ,lenGSR(iISS.J9 /pK-ZSM`M`*(+mtdZI(,bufZ Q,lenZSR(i\SS.]9 /p^-tpSM`N`g(X+mtdp(+ofsp(1pS()/rSW.rS2resrS(3s9 )2badt2)4N`N`{555-TSN`O`E)+mtdd))9 T-6SO`LO`)+mtd)19 )+buf)1/S)-ASLO`|P`*+mtd.*19 W*+bufu*1/S*2iS*3S*3S*3S+2p+.'.{.63PS<+ -S|P`$S`O++mtdz+19 +1, +1l +1+3S*,.S)S}.2pH,3S,2iS,.fS.S3S-3SD-.S)S} 7`R`R`3PSW--Q S$S`|T`j-+mtd -1 9 -+buf -1/ S-2i S .) S[3SA.3ST.(pW.'.{.63P#S.-W;S|T`U`.+mtd;.1<9 .+buf</1/<S/2i>S>/)>S[)?S})@SY(pAV.{B.C.'D63POSg/-bgSU`W`z/+mtdg/1g9 /+bufh/1/hS/2ijS'0)jSY)kS[)lSZ(pmW(oobnV603PqSE0-c|SW`DW`X0+mtd|w01|9 01/}S01t}S0-0SDW`\X`0+mtd119 811/SV11tSi12buf|1)=FSW)y<S}3S1)Y(iS[)ST.S/posS6X/__xS/__yS-S\X`X`1j+mtd119 11/S2.WS(buf V)=FSW-SX`|Z`12+mtd]219 21/S2)y<S} )S})=FSW2iS22lenS2/posS.WS.tS)S}) Y8p3 37Y`Y`2numS437Y`Y`/__xS/__yS6/__xS/__yS0|Z`Z`G3+mtdf319 3+buf 30Z`t[`3+mtd319 4+buf 242iSE43Sn43S4)SY.'(p Z.0t[`P\`4S+mtd419 5+buf 252iS[5)S})S})S[.'(p W.0uP\`X]`5+mtd519 5+buf 52iS6)SY)S[)SZ(p W(oobU0tsX]`]`67 +mtds:61/sSX6)u9 T*W ]`]`] +mtdW v6.Y 9 4]`]`^ 5559 S]`]`] +mtd 6. 9 4]`]` 555: ]`]`6!+mtd 6) 9 T* ]`^`]P!+mtd 6. 9 0^`^`6!+mtd 71/S)7)9 U; S^`dd`G7!+mtd f7/i S) 9 T<7!a !!#T!dd`d`7V"$mtd7=S7%9 <7f"a f"V"-5Sd`S+rawS93WS:-8lf`g`::$189 Y:+oob8:+ops9:(len;U<7%a7f`g`.,E %3F :3F :3G&;?g`g`$/__xU/__yU7pg`|g`/__xQ/__yQ % $|-uSg`Li`D;%+mtdo;+to;+ops;.S3/S;3WS;2lenS<)9 W- mSLi`l`.<&+mtdmZ<+tomx<+opsn<)pS}3pS=3/pSK=)pS}3pS=.q9 3Vr =(oobs}(buftY2retuS=.uS63SR>3S>3>62__xS>/__yS-GSl`l`>'+mtdG>+toG?+opsH;?.J9 2retKSd?@outghl`4Dl`Ll`V555-Sl`@m`?+(+mtd?+to?+len?1?,buf .9 2retS@4l`l`555-@m`ln`7@')19 V@+oob@+ops@+len@<77)a7m`ln`., %3 @3 A3AA?m`m`)/__x/__y7Dn`Pn`/__x/__y 7)')-(Sln`4o`_A)+mtdA+ofsA39 A(buf)l3 SA2retSAAn`555 );eS4o`Xr`B++mtdAB1B1SB3/SB2lenSC3WSEC)S}2retSC3SC)9 U)\3DeCB61 Co`*5554W q`,q`: 5e9ISXr``r`]B++mtd+D1>D-SS`r`16Gn1Ez1.KG1E1LKG1G1F1aC1L` F B3J2uK6 E 2KK1`L`E s3J2K7`L`E 2KK1``@ 3J2K7``E 2K7`p`E1L; S``&L4+mtd EL1 ScL/ret SL^ S 5 ASc  5 -  S 5 A S 5 SS S 5 S 0Q1Q#E2Q#3a# a r5r55- S5ASS5- S 5Se-5eSSSH5 3Sr5 SSSNS5 - SSSx WS bufWAlenWSWStdWiYSendYSpZALSFbufAtdiSpA?Smtd?5bd? 1@buf@A l@ ASlenAS!retCS!jCS SS2mtdS5bdS 1TbufTAlenTS!opsV!jWS!retWSG Smtd 5 1 len buf Aoob A!ops Smtd5bd" #Smtd#5buf#Atd$md$"& "SQmtd"5buf"Atd"md"#/S`H`vL$mtd5L$bufAL%1L$lenL&opsX'SH``]-(mtd5L)1Q)SR* M* SM!res+~S`P`1M)(mtd~5]M(buf~A{M(bdM,SM- }.iS}*S"N.lenS}*S5N*sStN*N-l} /0 0retSN1X`4`222223X`4`4@5&O6%7 ``k2)23``53OO6<8F4`` 2222{2o2d2X/x 65xO7`ĉ`J22223`ĉ`5O65O+SP`|`Ol(mtd5P(bufA=P(tdfP* P0iSP*SP"MS-sS}$- S} .dirS}*SP"|S-`S}0/ "S"18H` 2222/ 5P5gQ5Q#S|``Q$mtd5Q$bufAR%/S7R$numSUR%MShR%1SR%SR9resSR&iS}9jSS&actST: V;=S&len}:l} :}$&mskW< dat/ &tmp[/H __x__y#S``Sf$mtd5S$bufAS$tdS%ST: Z9resS8T9iSVT:MS}3ȏ`p`;1SiT+L;S``|T(mtd;5T(buf;AT(td<T(md<T,f =SU-? U-@:~0iASWU!jAS0resASU-AS}"MBS*sBS8V0dirBSVV*/BSV*1BSV-BS}0sftBS?W*@BSW-CS}"CS*~CSW*CS(X.mskD\-E} *F\X.lenF}.toG}$.opsH=*|`=(Ė`bS`0`X(mtd5X,1Y*  /Y0len SMY0res S`Y* SY* SY*f  SY0buf AY.tdT.mdU?out8`@@ 0`,`Yr(mtd5!Z(td`Z- T!iS0jS~Z-S}* SZ-7S}*O>S[*F[*[S+mtd5bufAbd!iS"S"S"f S!resS" !td!md!rd!rd2AXAc>rS,`H`[(mtd5[(bd\* \0lenSU\0resSh\.bufA}.td}$.md}(Bؚ` 2222/ 5\Br` {222/ 64} 4}5]65g]6665]Cd`C"`1`ԝ`2E2:2.2"7``223``5:_'SH``](mtd5M_* v_   -?hhb-* Ahb-P H4hb-"Ogb-Vgb  - ]z`hb-_gb-VhXhb-i\hb-=k\gb-ugb D- ``' P  %SintfeU~K0,e1,-6S%UeV,eZJ jAh lZNos MY 1(N# =FO# P#r \s# =Ft# @H| }# ~# # #  ? Y / # D# # |# 0- mtd.*# 2# len3# <4# '5# "F6# dev7# 8# 9B# 3:#$ +;#( EC<<#, .* BIv# f4w# 8x# ~# # # # <# ZS#$ EG#( S#, M#0 Nh#4 w$#8 #< -#@ *$#D $#H J#L "J#P p#T 2#X `p#\ #` #d fŐ#h Ѣ#l #p W#t #x ٢#| Y# H# # S# 3# # S# # M#<</0e? \A# B# C# D# ,Q 1U j6 Fk# lenl# m# fn# o# p# q6# r6#BHSh*<SS*n*S*S*SD*D*Sj*j"PS*v*S*S*S*mn S-resS ZS``_mtdZ*_datZ_{[Ridx]_ ]U ]_ ] `x ]} ]i^S` S``0` mtd*O`datQ b` u`s0`s1`s2`!@`\`҄ "`#@`\`$!a#`` a Ra  A a N - ``g) PSintUKtn#idH#,#!,#  ,#4,# idH#n# { d-  lhb ? d /lb-/!``) P  %SintfeU~Ku8%u16"3u32%e0,e1,-6S%UeV,eZJ jAh lZNos:  My 1(N$# =FO$# P$# r \s$# =Ft$# @H| }$# ~# $# # $ ? y   O $# D$# $# |$# 0-mtd.J# 2$#len3$# <4$# '5# "F6#dev7# 8# 9b# 3:#$ +;#( EC<\#, .J BIv# f4w# 8x/# ~# # # # \# ZS#$ Eg#( S#, m#0 N#4 w$#8 #< -#@ *D#D D#H j#L "j#P #T 2#X `#\ #` #d fŰ#h #l #p W#t #x #| Y# H#  # S# 3:# # S# # M#\\OP e? \A$# B# C# D# ,Q 1U  jV Fk#lenl# m# fn# o# p$# qV# rV#bhSJ\sSJ<JS J S9J9?SdJdJSJBpSJJSJ/SJSJm W$1 42S# W3# 14S# 5S# 76#len7S# 8S# 9S# " :V# S  SJS%~ t&4O C  #  ;r:#Ys:# u#Iv# w#Nx#{y#Y!z" #y{# H|#$E}!#(#,B#0]#4{" #8w#<{#@*#DcS#H4e#LS#PS#TwS#XS#\S#`!,#dnS#hFS#lS#ps#tS#x+S#|V#N#Eg#ecc ##G!( #ops#bbtV###T#3:#C XH F #S#8S#S# zFS#yS#S#Hg#" # 'M #$ r #(; #, #0* #4 #8* #<#@"""#D" JS SB JB VH ( Sr JVVVS S J VSx  J B  S J $$V SJ SS S"J S0f1f#E2f#3v# v JJJB SJVSSJB S!JSe BJeSS'S]J HSJ SSScSJ B SSS( ( e!\  ! # &!!#pad" # a##X  O?!.`L`]vmtd.JPcmd.Spaa/eanc1 12R Q!AL`d`]mtdAJP!ASQ-@CR" !JSd``]J a#!&e!-"!``* PSintUKE\,.1(/u#80u# '(H#),#*#9+u# ,u#1#   $ d2 $ $$bd%/#f4&,#&,',#(,# ),#*,#+,#V,,#jt6# 75 !P$ rbr%%#!% #ier&%#J"& #fcr'%#"' # lcr(%# !( # mcr)%# #) #lsr*%#"* #msr+%# "+ #spr,%#", #"-%# "- #!!.%#$w!. #%^"/%#(V"/ #)!0%#,!0 #-!1%#0!1 #1!2%#4!2 #5!3%#8!3 #9"4%#<"4 #=scr5%#@1"5 #Assr6%#D$#6 #E+"7%#H#"7 #I"8%#L!8 #M % d"@' -!="~HS#~"``a#a"H6`X GH"7``]0#H``]#ۜa1#)H``]t"H` `a%#՜bu"H `(`]c"(`D`]qcq+b#ƜIbnd"D`L`]cq\b"L``obcqb#b"``]cqb"`У`b,s,b#̜c q" У`أ`]Ys ,8c#Hأ``Kc"H6أ`p G  d "Aa!gd&X "T#-=#!`` ,!P$brbr%b#!%i#ier&b#J"&i#fcr'b#"'i# lcr(b# !(i# mcr)b# #)i#lsr*b#"*i#msr+b# "+i#spr,b#",i#"-b# "-i#!!.b#$w!.i#%^"/b#(V"/i#)!0b#,!0i#-!1b#0!1i#1!2b#4!2i#5!3b#8!3i#9"4b#<"4i#=scr5b#@1"5i#Assr6b#D$#6i#E+"7b#H#"7i#I"8b#L!8i#M byy "@  !% T#`h`jc {#|Pa#cint #+h``c  {#+|Pa#+cn#;`Ԥ`]9 {#;|Pc;9QG#B9Ԥ``]k{#B|c#M``]{#M|cp$-$#``, PSintUKtE\,. 1(/{# 80{# ' (H# ),# *# 9+{# ,{# 1#  * d2 $. /n# #0H# #1H#cmd3# 84n# n96n# 8:#HHH5nHHtH#>5* $$bd%# f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7$[[6[{t#aidxaHcvalcn t% d #AH``c$$A d&AH2d#AHEdp8AXdiCHbdDT``F` `G `0`H0`@`K@`P`L5P` Qf dkd T`d`M!gdX"##xbn$&-N$#`x`- PSintUKtE\, $./n##0H##1H# cmd3 # 84n#n96n#8:J# H  H H n HJ H  t H &#>P 0$!,``~d @!d #!Hd p8!d { H  *$&H`x`dM $$&[e &&He #&H [eE\,J jAh lZ~% Xz# 8#(P5 cnt,# 8# (5# E  lmbn ># J #P. 1(/# 80#' (S# ),# * # 9+# ,# 1&#*  crc# -@# n6 2 $. /# #0S# #1S# cmd3# 84# n96# 8:#SSSASSS#>A &@ &# '# '# '# '# '# x&# c&# '# v%# %# $#  &$h 1(# end# W&# %# _A# WA½# BI½# os½# (&,e *'e# $# %Ѳ#D osh#H ep#` '#d %(#h :%#l '#p !(#t '#x '#| kbdk# (S#+S#lmbE#6$s$ $ bd %k# f4 &,# &, ',# (,# ),#  *,# +,# V ,,# jt 6#  7} %*(f5STSSTqa(d(}hdr}%|hdr|*&Shdr?(ShdrBI pZ"x pZf%nAhdrn'S`hdr%Shdrr'qhdrq$hdri&hdrM(hdr(~hdr~&{9hdr{'Xhdr%rwhdrr'shdrs&' $$'&'S#'Sp8'w((T'( (( hdr*e~(+ 8'x`|`]@ !lmb@ PE $|``]k !lmb@ P"&``]#>(BS``e $&BSe$#BSf$p8B8f$w(CTVfq$E % k #V%S``tf $&Sf$#Sf$p8f$w(T0g& &%e}'hdreNg&%\(K%lg%(Ug)`p`'leng'iSg% ke #$(S``hm $ (?w(qb&}$4S b@H mb %AB7( Cgd<4X:D  <O @"&?mb q E&ambE_'  ybE& N8) EC# sC#_%)<'5 f4(H# ext)H# *5# 1(.K# )/K# v#3b# ,4z#$ #8K#( O#9K#, 3={#0 :>_#4tEdHE] ]tQt t]h/) x }) H``n6cmd Yo& H.o# HAop8 Tol"H:#Vpos$Tdev%6Z`` ),<B8)_6VB)VKnsdP)Wc (FNyb0,-)#` `2 PSintUKO $./y##0H##1H# cmd3 # 84y#n96y#8:J# H  H H y HJ H   H &#>P)* op+y#),H#)/a )Ry sRy )sH ssy tsy opsH wsHlugrug\)Cg`h`goEsCyowCHolEgopEEg )\H s\y t\y op\Hn^Hp^Hl_yr_y__xen__yenw)Hh`x`oopyod)ypi)y;pwHYplenHiH)wp̵` n ppK$`0 ne\P xq@`T`Rq4`p b$` a)Hx` `pqn$$[q&Hq#Hqp8q6HwHr~d n)1nnb )Pyb`---# ``3 PSintUKtE\,. 1(/{# 80{# ' (H# ),# *# 9+{# ,{# 1#  * d2 $. /n# #0H# #1H#cmd3# 84n# n96n# 8:#HHH5nHHtH#>5* $$bd%# f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7 td*z+3*r*,,,+ ,,, + ) P, f* *,,n-+**-+i,**F*,+ [ \n# F]H# oG^H#1+bz+'-+@tin@t)JH/JnzFLH.--H H,B-Hbufnlen{pnct `@`] 0r@`t`] Cr! Vr"[,~t``]#z*``]$|,tP%e+`и`irи``]>&ظ` "``]b&` '*.``r(|,tr)0` *'6.7``r+ -9Hr'*T`` s(,Tn,s',``Js,nHis=FH+Hs-x``[ t.|``*/|``! &t'?.j`(`9t,njHXt.``q*/``0 T'*](``kt%,n]Ht.d``d*/d``0 T1){``t(\{t28HU3buf4errHt4resHu2X2+w+ *{Fu+ {du t d5;*H`̾`u6.{:\{8H7iH7buf6 -#H|,%tN-&t+&t7sum'H,(H=F)H7n*H-*H,*+HV-+H8,b8-9 .H̾``u ($$ u(&Hu(#Hu(p8v+\{Ev {+!,Hyv]-H+Hv7sn)` * :!v!#v0-@;-`@ *;):`` :!Lv!pw<|!w<!x<<=`=`Y+{``x ?\gx@G- y@q+ }@*HTABIHx@ {PA8{xBbufA *{xA!*{ yA*{(yA*HyCN`@*j*_:p!uz!~^z t d t dDV+6H``z ?$$6 z?&6Hz?#6Hz?p86 {A\8g4{A 9{R{Ei:Hp{Ax+;n{A [TE\1 $. /s# #0M# #1M# cmd3F# 84s# n96s# 8:p# M: : M M @s Mp M @ y M @L#>v .&M``{"$$&{&&M|#&M%|p8&@C| (a|=F(t|crc)|ptr*" /M`$`|$$|&M|#M|p8@} r/uM$``1}}$$u\}&uMz}#uM}p8u@} w}}1(w}}endw}~valx9~/yb~zM0{MY/|M}/V" ~, f/M``~_$$~&M~#M~p8@ 5=FSi.8M40_/jcpuep{ /fM``%$$fD&fMb#fMp8f@ hǀThY -h8iMT :0M`h`X$$.&ML#Mjp8@I.O. -|T/8MM Z/QW`/R``10;Ճ0<0FS0G.Mh`4`ф$$&M#M,p8@J U/W -h8MV.M4``$$U.Mڅ&M#M!p8@J i/M8M$ s/M``9$$d&Mw#Mp8@.M``^$$&M#M p8@*.?M``=$$?h&?M#?Mp8?@͈ A=FAW8EMrcFM'7pb'03|b03b.4pnb&/5tb.5xbyg  /\ !^.vzb!n.v8zb!.vTzb!~.vpzb!D/vzb!3/vzb!.vzb!/vzb!/ vzb!/v{b3-E0#`h`Z: PSintUKtE\, $./n##0H##1H# cmd3 # 84n#n96n#8:J# H  H H n HJ H  t H &#>P c0H`h`P $$[o &H #H p81( {TqW!{UP0DP4{b"v4-2#h`d`: P  %SintfeU~Ku8%u16"3u32%e0,e1,-6S%UeV,E\,eZJ jAh lZNosS $. /# #0S# #1S# cmd3# 84# n96# 8:# SSST SSS#>TK 8)^ EC^# sC^#5 W& 3'5# id(# }1)# 1*5# '4( 3:5# BI;# num<# 8=# 0># 3(- 3.5# /# 20# 81# \2# 33K# a44# q15# dev6#$d  M 1(N5# =FO5# P5# r \s5# =Ft5#@H|: }5# ~:# 5# J#5J?Z  5# D5# 5# |5# 0 -T mtd .# 25# len 35# < 45# ' 5 # "F 6 # dev 7#  8#  9# 3 : #$ + ;#( EC <#,  . BI v# f4 w# 8 x@#  ~#  #  #  #  # Z S#$ E #(  S#,  #0 N #4 w$  #8  / #< - _ #@ * #D  #H  #L " #P  #T 2 _ #X ` #\  _ #`  _ #d f #h   #l  2 #p W 2 #t  H #x   #| Y c # H c #  Z#  S# 3 K#  o #  S#  H # M  #T e ? \ A5#  B#  C#  D# , Q 1 U  j F k# len l#  m# f n#  o#  p5#  q#  r#* S S  / /  SY  Y 5 S    e S  ) S   S    S2 @ SH 8 Sc N mi 4+ new+^sC,^EC-^61V sCV^ECV^/)  x M3S =)  8)54=5 new=^=)=^c1JY newJ^=)J^81br @b^3 :^2  BI num @ ^2  )  & ptr &M0I 0~3e@^!id  ) 1 BInum@^!id  ) "0 dev.4!u32S dev222 13S3 id325!dev627 93Sj bufR2!retS0S =)^@^!n^2  ) Y2+Sbuf+R2+\1-^Z4-^!dev.2/ u4/ !p03182\2!len2A1293#1$ )@  )O %3 h` `܉*&dev'3e0(@^N(2 l)numS* ) +3 ``,buf`-l0ӊ.2 -Z4^/dev03`h`]1buf28ٚN3)1h``4buf`%3S`l`>&dev̋'2 (@^4 (P3 h5 ``v6 7!pi  85 `(6M 6B 9{ `HL6 6 6 :5 ``%6M 6B 9{ `L6 6 6 8 @`6) 6 9{ @`?6 6 6 30l``'=)^ƌ(@^4n^T3 ;Y ``6f < ``d6 6 %1S`0` 8&dev,5Y ``!6f < ``d6 6 ; ``6 ="3,0` `J1ptri24u |>ret,?~2S `8`&id؍'4u 'v0'v22)pP?2S8`4`&idˎ&dev'3'20(Z4^N@\1^[(BIa(X3(2)p8 L`6 6 *A #B  14S`id424 !mtd6!17!i8S!j8S1(9#3i#B4|%!2S4`4`A&idl'2 8`6 6*(AԐC#PA/A9GACDODW0HS}1HretHu =2H2J 8K,\L,M03NSa4Oe!pP%E2:S4``'!1:>&ret:u ' 3:)dev<(2= ג!id>0?~3@e)pAA@l3B5T(@C^)nC^@}1D} (\E6!errFS: x`HX6 6 *`A# B/ : `xh6 6 *A B E` ` )j :P`py666*B*A6ABHAN|AZCf}Ar8r `H6 :5 8``6M 6B 9{ 8`L6 6 6 :r `6 :r `6 8Y `6f < ``d6 6 ?1S`D`2'BI]&nump'8)mtd@!1`Fj D``ʖA B B 6| :Y d`6f < t`|`d6 6 ;r ``6 G0S``!4Sids!p0~3S!id@^!n^1BI!num8!retS$ ) $0S  )  ) 1TS@2T!pV!devW!errXS?/2S`d`<#@1Sb)idsh@1}(J1(1S@1:!`?63*@A?AIʘAUBaAliBxBA,AAB:Y ``pd6f < t`|`d6 6 :Y `6f < $`,`d6 6 5r X```6 *B:5 `6M 6B <{ ``L6 6 6 ;r ``6 :`J6*A>A'B3:5 `0z6M 6B <{ ``L6 6 6 8 `Ht6 6 *pA қB :r @`6 :r D`6 H``4pi X(0j(2k? 2Sd`0`/'$$)Z'&Sm'#S'p8)dev@2 d(2ܜF3 0`(`pA] 46Q 6E 8 4`*A RA pB BAAC)@B5CA} AMCY}AeIq`6 6 Hx`|`B"2Z4^\1^2 !dev3S$ )  ) l4S dev2 .4 P3 ?3S(`d`!'$$)'&S7'#SU'p8: `4! 6 *8C _A A& A8`h?66*B:Y h` 6f 9 t`d6 6 *Am7!@3!(BI)num)len6)dev2!id)p : $` 6 *(B 85 $`@)6M 6B 9{ (``L6 6 6 :I `x1!6g 6[ *As &B : `d!6 6 *A ZB E4`8`~! )! 8 8`"6 6 8pX`*(A~A͢ABA !?J2aJI4a"J0 "b?"KJk2."bJ]3b%l"LM7( a"N'45bNH5bN1bN0bO2AP{bO2dl{bt8-4#d`LaD P  %SintfeU~Ku8%u16"3u32%e0,e1,-6S%UeV,E\,eZJ jAh lZNos $. /# #0S# #1S# cmd3# 84# n96# 8:# S  S S M S S  S #>M &@ &5# '5# '5# '5# '5# '5# x&5# c&*# '*# v%*# %*# $# *&(K  M; 1(N5# =FO5# P5# rd \s5# =Ft5#@H| }5# ~# 5# #5?;  5# D5# 5# |5# 0 - mtd . # 25# len 35# < 45# ' 5 # "F 6 # dev 7#  8#  9$# 3 : #$ + ;#( EC <#,  .  BI v# f4 w# 8 x@#  ~#  #  #  #  # Z S#$ E )#(  S#,  /#0 N J#4 w$ #8  #< - #@ *  #D   #H  , #L " , #P  R #T 2 #X ` R #\  #`  #d f r #h  ф #l  Ԥ #p W դ #t  غ #x  ل #| Y # H #  #  S# 3 K#  #  S#  # M #  e ?o \ A5#  B#  C#  Do# , Q 1 Uu  j F k# len l#  m# f n#  o#  p5#  q#  r#*$d* SJ  5 Sy  y  P   S  y  S  y   S&  &  SL  L 2 Sr  X  x S  @ S  S   m 8)  EC  # sC  # W &Z 3 ' # id ( # }1 )# 1 * # '4 ( 3 : # BI ;# num <# 8 =# 0 >#Z 3( -> 3 . #  /# 2 0# 8 1# \ 2# 3 3K# a4 4# q1 5# dev 6> #$ W$ 1 4 2S# W 3 # 1 4S#  5S# 7 6 # len 7S#  8S#  9S# " :# S *  S  S D  ~< t&4O   b  # ; rK#Y sK#  u#I v#  w#N x#{ y$#Y! zA#y { # H | #$E }@#(  #, a#0 |#4{ A#8w  #<{ #@* #Dc S#H4 e#L S#P S#Tw S#X S#\ S#`! ,#dn S#hF S#l S#ps *#t S#x+ S#| #N #E )#ecc # #G! G #ops #bbt #  #  #T  #3 K#b XH 0 F < # S#8 S# S# zF S#y S# S#H )# A# ' l#$ #(; #, #0* #4 #8* #< !#@" "A#DA  S0 Sa  a g*G S    r S    S   a S   5 5  S!   S S SA   S' 0 1#E 2# 3#** *     a S   S S$  a S @  S e*a  e S SF S|  g S   S S S S   a S S SG G&#;5X 4dP =Fe# \f# 5gS# s5hS# BYjS#4npZvxpZr'q5hdrqa(d5$5hdrT2S2ofs2 +5d``2=!idxSQ"T"U# 5S``o/$$$"$$\$  %cmd(&r S&ep 's G'cnt p&hdr (``,)*v``)+@,4X/T?-y5(S``.(!off( .5(S>/i*S\"+Z0+z/p+1 42ops5@4_S p_num_ 14a3g5fS`t`&$$$f"˥$&fS$#fS$p8fF4I5hd&idxiS4 j4\j'devl> B42m&n,2ng58`+X'pq*$`P`r))6$`P`7P -4hSt``ͧ.#hS.p8h .h4!offh R.8hyp/idxjS/devl> 02m&"2n_8out`9`xp))+:9`3))+:I;x``yd))6x``:<(`X`))6(`X`:=#5S`La.$$".&S}.#S.p8>iS>devS/retSE0 /off108ج/cmdJ/s105S604_58`?`,))@,oY7PD449S'o:S4BY;S+ 4-tSE+8AopsBHB+%SDCB&9DU5{bD4{b-<-5#La a>H PSintUKtE\, $./n##0H##1H# cmd3 # 84n#n96n#8:J# H  H H n HJ H  t H &#>P H{ g l ARP   DNSNFSCDP 2 { gl6HLaay$$[&H#Hԯp85^7tmp`7tGd6Ha a;$$[#Hp8snendnHp8H {aPp+L a a4Ln/d'6RH a a]$$R[&RH5#RHHp8R[.6EH a a]$$E[n&EH#EHp8E59H a a]7$$9[Ų&9H#9Hp89 5.H a a]$$.[&.H:#.HMp8.`66#H a a]$$#[s&#H##Hp8#H{ <a =a >at.d <B LCtZd? DJ NJa Katd j s ra!5,P{b!?67P{b!5BP{b!5NP|b!5[P0|b"5PL|b>-7# aHaI2 0 PSintfeUKE\7h lZ. 1(/# 80# '/ (S# )7# *[# 9+# ,# 1a# *[ crc# -@#/ qz2 $. /# #0S# #1S# cmd3# 84# n96# 8:@#S  SS|S@SS#>|Fq $$ bd%W# f4&7# &,'7# (7# )7# *7# +7# V,7# jt6# 7] 0 z% pZ+x pZk6YS a a]6JS aD aʳs1J i2JS6SD a a\{bufleneiSմnxtSVvalSnS70S a a:m$$0QY&0Sl#0Sp80* a aĵiSWnxtSTvalSv6S a a#&S #S p8>iS\lenSS S϶env nxt n !bdW[ 6  " a$avalTA"paasjTekr# l7valo$ aa%&, Si Sθw6S a8a$$Q &S)#SGp8e,S8aa66̹&p8h z'b6fSaaLf+fS3!ihSU!jhSZciQ!bufiLL \z7SaHa$$Q&S#Sp85iSS Sq  7z(6Ma)(o6WStnb*H ;z+ j+,gd5VX\-+62.6=Fh|b.U6^F|b.6gF|b.6F|bA@-e7#HaaL P  %SintfeUKE\,J jAh lZ $.!/##0S##1S# cmd3L# 84#n96#8:v# S@ @ S S F! Sv S F S FR#>|&@B&#'#'#'# '#'#x&#c&#'#v%#%#$B# R z&Ra(d(}hdr}RpZxpZf%nhdrn'Shdr(ShdrBIi&>hdr?7/SHa0a8 /̻(7/8len1hdr2]-@3CGcmd4{5S(6SaaDaaaa]C8EC>F7S0ataa$$ʇ&S#Sp8Fڽ ̑TS(78 r7Staa$$&S5#SSp8Fq!27||b"P7||b[XB-7#a$aM P  %SintfeUKE\,J jAh lZ $.!/##0S##1S# cmd3L# 84#n96#8:v# S@ @ S S F! Sv S F S FR#>|&@B&#'#'#'# '#'#x&#c&#'#v%#%#$B# R z&R(}hdr}RpZxpZf%nhdrn'Shdr(ShdrBI(~0hdr~7%Sa$a/$$%&%Sؾ#%Sp8%F 'UT(=-@)[len) -)(*SZ2+S3,/Lhdr-]PaTaLPaTa ? z H}7|}bN C-9#$aT"aN PSintUKt $./n##0H##1H#cmd3# 84n#n96n#8:?# H   H H {n H? H  t H  #>{E tg dk8Hsn 9Hp8#H 81Hp81i3Hlen3Hs94ns4nt4n80cmd08?$$P6t70u80sep0Y9Hp8llHslHlenHiH7HG#Hp88t 8H7$$Pp0lenH8H8Hcmd08H$a|aѿargnE8HlenH-0H|aa7"$$0PV&0Ht#0Hp80i2HV82HW(p5nUc5t8vHaxa#Q$$vPB7 Hxaa`$$ P& H# Hp8 7Haa]6#Hp88t 8H07NR860b|8H tG d8PPaacmdP0 PP9PH $$RP z9SP&!pT09"lenUHU 8VHm8pPaa]cmdp0lenrH#!9a(a$aag%% &aa'#$aa%% &aa'#(a(a%% &a(a)#P8H(aa8P7Hc$$P&H#H+p8miH*HH+9iHjH *9H2,h!tmpPE 80 P-d8,Ha a2$$,P&,H#,H p8,8IH aT"a/ 7I [bufInnnpI 8I "nKH} !colKHp8L 7M ~!sNn>!tNn!sepO0!iPH!jPH!kPH!lenPH 79PH. #PHxcntQH 8Rt.gaa %%/y"0.ad %%%%'V' '0"0.):}%.xa@xG %X'k00''1;ap%y'0''C%m%a%U%I0H n 2d n 2dR8GV0b38@E3Z8AE t 43" 57+E,}b538MEH}b6a9=Ed}b6>9AE}b F-)#T"a'a2Q PSintUKt> [OE\,:(:G:# :f . 1(/# 80# 'N (H# ),# *T# 9+# ,# 1Z#Njd2j $$bd%u# f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7{ 8)> EC># sC># %)<' f4(H#ext)H# *# 1(.# )/# v#3# ,40#$ #8#( O#9#, 3=#0 :>#4tdHt***+3*r*,,,+ ,,, + ) P, f* *,,n-+**-+i,**F*,+-:H H::H'H9IHc9kHs*/) x 93HT"a"aw3Hdev3fF5HD w:H"a#aH;!#a#a"#}:H#a@#aYY$Hx% (#a8#a"&9@#al#a$H'c%'P#al#a "?"4&9l#a#a$H's*#%I|#a#a"a"V(:H#a#a]<$WH6)sCHR*9H#a#a]+:#a#a],dbg#a#aI-fmt*.*9 H#a#a]#:#a$ah$f4H$n/dev#h:H$aX$aY$H$Pn0&H&/devD&:X$a$ab$H-fmt*.)4p1i{):wt2d3,]$a$a]'s]*&S,$a$aJ'fmt*$4-1i{):w&,r$a@%aK-fmtr*.)4tt1iu{):vw4L:@%a&a#9H&a&aC 090#:1iH0:>/pos>/dev95@&aD&a6 )C I 78)8:&a@'ab 9fmt*.:4Ҷt;i{::Խw3v#H@'a\'a] 'cH*#8H\'at'a]*O#(Ht'a'a]<9H'a'a):H0b):H4bA =>B)V6 n^ d>P)WN ?gdx X~ @ h ^J-"=#'a:aS PSintUKO<!H6n<@yE\,. 1(/# 80# ': (H# ),# *@# 9+# ,# 1F# : V d2V $$bd%a# f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7g<(\;]H#?;^H#<_H#;`H# =aH#z=bH#<cH#<dH#>;eH# <fH#$r<#<#8#fd#bk# <<;C-<oldnew='a (a]pppiH,  (aH(a]*R6; HH(a<)anpad 2; gE< gc; = < , |(a C !*v"6# (a !"*6$,{ <)a+a5mem{ %p %hd 9%sz m%idx HEC -= 5< i%bck %fwd = HRN +a+a]^mem &='nbbrk;k;=;6;;;=<,,v+aT2a(vk<{7<|m%idx}H%bin~~;^4=g|=H ,L;HD%fwd%bck%qC%nb#^l-aS l! wBU"""" t-a@)P!`*68# 8.a !*a6C< T2al3an(= ( %nb /m *p U*brk Z:   M= ~; `4= gs+.;S l3a3a](S X +/;D 3a3a](D + < 3a3a] mem %p +v; H3aL4a]J (Q< H,6 HQMc L4a45a nc (<c 8%ph K%cszi iszk d;p |X=q *mems T!< !%mz $;45a\5aJ (1(4(8Gr= \5a:aZT (= y( %nb DG; x= :   @d< EC  ; sC  O= 6~; _4= %bck r%fwd -; 6a. L< '/T6a6a; P^< y07a7a 1L< R. L<u /88a8a;u ^<u !8L< (/$9a9a; Q^< e 2d*av_T xnb1:C,rb1:D,lb1<EOxb1;F,rb1<Irb1c=L,pb1;O,tb1<RDb3C=\ 4,5;%ZSc%>ZS%@:a$:a]R$:aH:a](>%H:a:a]SZS!c%?@\:ax:a2^x:aPohz= S:a SV$8SY%=<=%><f&:a;aB'(G> 8/5 %,z-m><rbo O->#Y2 0 P  0SintfpUK07p17-6S0UpV7E\7eeJ jLh leNo~.] 1(/# 80# ' (^# )7# *# 9+# ,# 1# * crc # -@# 82] $ $ bd % # f4 &7# &, '7# (7# )7#  *7# +7# V ,7# jt 6# 6 7 0=  M 1( N # =F O #  P #  r) \ s # =F t #@H |q  } #  ~q#   #  # ?     # D #  # | # 0 - mtd .# 2 # len 3 # < 4 # ' 5# "F 6# dev 7#  8#  9# 3 :#$ + ;#( EC <#,  . BI v# f4 w # 8 x+#  ~ #  #  #  #  # Z ^#$ E #(  ^#,  #0 N #4 w$ J#8  f#< - #@ * #D  #H  #L " #P   #T 2 #X `  #\  Ö#`  Ė#d f 7 #h  I #l  i #p W i #t   #x  I #| Y ܚ # H ݚ #  #  ^# 3 6#  #  ^#   # M I # e ?4 \ A #  B #  C #  D4# 7 QU 1 U:  j F kU# len l#  m# f n#  o#  p #  q#  r#)^^>>DfP^>l^>^`^  ^7  I = ^i +O ^ o ^  m &# 4d =Fe# \f# 5g^# s5h^# BYj^#4n T2^= 2= ofs2 -^ -= ofs-len->buf-G(^ (= ofs(len(>buf(>S%d^U!>Y"len|#>$ H=a %1 %& &C =a=a%u %j %_ %T '>^=a>a (\)buf*end W+> U+> Y,len -> . >ac %1 %& / X>a|>a% % % % 0>l>a>a1>\>a?a7 2ret_^6^?a?aV "ret^!4 d 34&  %# 34m>= 56?ub5 >HT |b6gdQg Xm 7R-?#?a@a>[ PSintUKE\,.1(/u#80u# '(H#),#*#9+u# ,u#1#   $ d2 $ $$bd%/#f4&,#&,',#(,# ),#*,#+,#V,,#jt6# 75*+3*r*,,,+ ,,, + ) P, f* *,,n-+**-+i,**F*,+??a?a]+ ,?a?a]&??a@aiHgdX S-A#@a\Ka"\ P  %SintfeUK0,%1,e6E\,J jAh lZ ~% Xz# 8# (PG cnt,# 8# (G# W lmb ># J #P. 1(/# 80# ' (S# ),# * # 9+# ,# 1# " 2 &@ &# '# '# '# '# '# x&# c&# '# v%# %# $#  &3 $ 1(# end# W&# %# _A# WA# BI# os# (&,| *'|# $# %ѽ#D os#H ep#` '#d %(#h :%#l '#p !(#t '#x '#| kbd# (S#+S#lmbW#"$@ $id%S#&#c@'#@( $$c bd%# f4&,# &,',# (,# ),# *,# +,# V,,# jt6c# 7a(d(}hdr}%|hdr|&{hdr{i& hdr?@ @msgidSwA eeos k?e?@eBI(~hdr~t?eWA pZ x pZf%n)hdrn'SHhdrr'qghdrqAhdrȡiʽ -ʽ 8ˤ@hdr!A hdr "ose#?e#BIe#WAe%r2hdrr'sQhdrs(S|hdrBIV?thdrt!9Ahdr|val2@ohdroe?S hdros*&S6 hdr?ASV w(V |@ ~(#?$g@a@a] %y&'&$ @aAa] %%(%4 $FAaPAa]* %Y3( AaDAa) % Q* S$pPAaAa]o %o+ PAa) % % $AaBa] %+ Aa) % % $BaXBa] % + Ba) % +% I$\ XBa\Ba] %o \&{ $6 \BadBa]8 %I o,dA/SdBaBa - /@-@0e-0e"t2@.A\SBaBa] -\e.K@EaDEa)](H@EaDEa)Z6|tEaEa)7@%EaHa9ptr%"hdr'"p(e?Ea6)5''='f'@FaFa)?Fa) + Fa) ) % @LFaPFa)?HFa84* P+ HFaX% * R* Q@FaFaN)?p Fax*= P+  Fa% * R* Q@EaEa)+FEa* P+ Ea% * R* Q@KFaFa8)](HFaFa)Z@FaFa98)%@2 Ga$Ga:R)D@QHGaLGa<)o)c(HGaLGa)5:i>S0A-@?N:len?nA -@(gdGaGa@) BdGaGa&&&Ai>HAi?i(jS#O?l,@SHa\Ka-#S-p8--w(V 4-?-' -%( AHA#\AA*@$A5?\#O??IaV)%)) 58&1?ptJa`s)= + tJax) % % ()IaIan);( IaIa)@KLJaPJa])](HLJaPJa)Z(PJaTJa\)  E: $$bd% # f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7&tdC4strn1BHJCHnum4C4bufnlen,,nCEneretGnfCHH@CZnret\nC8C8nB)i+HCHBHHiHB2\Ka`Ka]val2HPBTH`KaLa] CTn p8T !"CVHTBABnctsCtNBBHCH+HiHBCnCH"tCHLaXPa k#cmdL &Hu$$$!xCw:C n%sep n!5C o%str n!p8 k$#H$BH!#H}%rcH&&]\LaM'we(k)*+*+g++,NaNa+-g+*n{ d\BHXPaPa $$= &H[ #Hy p8.iHW) argn/ZC4nPaQaq /4n#p4n 84q#np4qO 994Hm%s6nH0CQaRa cBt JCH #num43 C4Q#bufn#len,$(C,CH 7 bufnlen num,C,uK,(C,cBtJCHBHrcHrB 1tmpBH1tmpMH1CbntmpuHCHcolH"Ot d9BHRa\\a 7 0 /nd%pn%lenO%rcHB!-CHb2RaH J (+(() +7k+C+[+g+s+^*-H*O3L[a[a# (4XaXa: +5 V ++o3Ua8Ua (('(((((4XVaVa +2Va  ((('(((()!+2:[a !g )8!*X*L4xZaZa' +T6eYa4Zai,Ya4Za*w5P! T8n%nH$99Hv%colH%ct26WaWa,WaWa*7iBH\\ah\a] 7 |8{Bh\a^a !Bb%lenH%rcH$&H%sn4$BHRp n68]a]a(,8]a]a+p,h]a]a+t d9BJ wb9CKwb!BHb!B Hb!QC!Hwb:gd, X% ;</Gb=(B"Obn_ d=C$O bt d d=B%r bZ-D#^acac PSintUKu16"38) EC# sC#.D/ 30# 1y# -2&# *4K# H  y % % 3 HK y % % 3, 4+ new+sC,EC- 3: /)  x c1J newJ=)J!E?^a^a]^a!ACy^a4^a]DH4^a<^a]SPy %QiD<^a^a@TdevEH^a@_aPy %1reg%O63m@ƶdevDžVDHDHDH@_a_aPy %reg%6 5@SdevVDHxDHfCDH_a|`aPy %QDdDd  D$`a6DPH|`a aa* }PPyU  P%s QDRd DRd  D}`aD&H aaaa P&y  &% !reg(37 C)Hz DHaalba jPy  % "ouij Ep #revp!regO; !tmp3Y O%D|Hlbaba P|y @~TdevDIbaca Iy -J& *LK @O: &DPDQ03ROW$Xca`cakL|ca!v%QcacaLti^`D8bD9b\-JE#cafae PSintUKtE\,UEHct ^EHca4da] snM  iHk  jH  caca ca! 4EH4dafa An  -H   -@n  i H1 v!He@E"H-E#%rH{]-E#fa\haf PSintUKtE\, . 1(/{# 80{# ' (H# ),# *# 9+{# ,{# 1!#  1d21 $$bd%<# f4&,# &,',# (,# ),# *,# +,# V,,#jt6# 7B 8) EC# sC# %)<' f4(H#ext)H# *# 1(.# )/# v#3# ,4#$ #8#( O#9#, 3=#0 :>#4 tdHt4+,new+sC,EC-c1JPnewJ=)J3i:yEGdevI /) x Eofafa]Efa [pE\,J jAHkSh le@.,waxa<8.= s.<| m0 n0V d1U c2 BH^xa$xaH_^$xa,za _-@_,cV_ -_H_Ha uipb uspc ucpd  ie^V?   %17(&I>f-IH,za|a n PSintUKt[H8%VH:ONI;,:HA}GIJ{H rI   H 0 0  |I<% jI0# I# I# 4I0# I# I# msgn# +B# H# ]I#$ cI#( =IH#, H #0 I#4 J#8 %IB ?H#%TI6H^H,za({adst^{H^H1src^O^xH_H\_HsaHrbH%,H>H({a{aDddst>{oH>Hsrc>>i@Hf4@H]I9{a{a]x9{< 9{Onb9ObH-{{a|a]x-{u7-O8-Op/{= h-JH|a\an PSintUK0,%1,E\,~%Xd#8o#(Pcnt,#8o#(#  z lmb/ >#J #P %J5}m J5d J5o J6d J6oyJKrgnKrK,iM, J@}rgn@r1A,r2A,JCdJDoJEdJFoIW(rgnWr1X,r2X, I/}f J/d J0o J0d J0oId d8oeJ}rgn Xd 8oi,Jd]JoAJd d8I|a |a]6lmb6P8J^ |a4|a]almb^6PNJp}4|a~argnpXpd#8poAJr,_Js}is}"J}d]J~o=/l|a" a V K @!(}al}a   "(}al}a#q$} ##/@}a"H a V K @%l}a}a&  %m|}a}a[  z"|}a}a'(I}~a~a]2lmb6bXdu8oI)J}~aalmb6Xd8o" rgnIdV Jd endd iH %m(a\a  z"(a\a$Z(@'}aa]Almb6!Xd!8o+!I*aDa>!&]!+Q&{!$R,#$\'(a0# Z O D 9-IdDaa!+.lmb6!/8o!/F<"/Jd?"0i }}1j }2X!dh"2J"d",P#3J%dZ2 J&o"4flap#.  x5faa+  x4a#3 f _ V,##",###'(Āa# Z O D 96faa?  x-JEHa a5#.lmbE6T#7 EdQ0iGHR"aa8LJd-Id aTa}#.lmb6#/8o#/F<#/Jd#3I dV9IdTa\a].lmb6#/8o$/F<$$ Pk-GKH\a apPintOU\ SK6DsKs޷ sc \ K  s Kpa -  K(VN cs( ct(sc1*sc2* 9K/ cs ct -su1su2res/ jzKAVTAVsrcA tmpCV\axa]PQKVVxaa]eTVV7$srcVQ -VR tmpXVlKgVa܂a]TgVJ$srcgQ tmpiVK~V܂a@ah$T~V$src~Q -~R tmpV*/@axa]?cs$ctQ!Kc$K/xaa]cs%ct+% -R!KcI%XKVaa]sg%c/%KVa`a],sη%c/%pз%a#$`aa]P %!SJaԄa]s& -.&scL&"ԄaDa_& ~&Q#&" Daa& &*Q#5&A$*K>Vaa '%s>V)'&ct>Q'eK@V]'']@V'(a $F@$#')  a`$Kx$5A$K_Va8a'G%s_G'&ct_Q*eKaVS+endaV(, aaf-aa5AV.KwV8aa]%sw3(pyVqyV$tmp\.@Kaa]%sF(%c/Y(/ -RxsV0$_KVaal(I%src(/TVQ/ -/RtmpV.Kaa]1T(&srcQ/ -RtmpVsV.PKaTa] 1T(%src(/ -RtmpVsV"NTaa(K a) l*)wR#H).1KaԈa]1 )&c/Q/8R+p )j$KVԈa|a) %s1)%s2*+l1/?*l2/(Ԉa$! ?$2a(a"J ?-a(a,N0ada% 0h*'-0ada.K7|aa] %s7*%c7/*&n7R+p9*KVa a*g s*newV(+3aa< ?-aa,aa-aa4'K9Vpb5j 677(y  Hn-%LH a|ar:(0:HG:H#:f%PintU  SK u8 { L, c, L{$ buf{ qt d3t d2t d1t d0t ?L+{L buf+{+MLp{bufp{ pKp_Lq_f4q_oLspt{iu_ UK{@buf{ K_L_f4_L@p{i_PU'K{buf{ K_L_f4_L9p{i_0L_UU L_ s i_ ! 'q-2X a0a;+cp2!Z+$2QX2tRE4X+64X++Mm0aXa+cpM!+$M+XMt,LT_XaHa8,3cpT!W,$Tj,XTt,EVX,L{Ha$a,buf{,qt-d3tK-d2ti-d1t-d0t-gL{$a,a-Ubuf{-numX-$ remtLa$> . G.%!{.!.!.!.8%!Kt."A{,aa.w#buf{'/#numXE/$X_n/$8_/$L_ 0$BI_N0%0Lwa&tmp|%r:} '`L0%K_}(i _0)܎aa^'O._0'/_0*ȁa(cL1UA+Kaa1,fmt!-%4Jt"\{aaP1L#buf\{o1#s\{1$K\_1$L\_1$f4\_1len^_(i^_2L{fmt!buf{ptrHK_L_f4_.xL_aLa;2o #buf{g2#fmt!2$4J2(numX3'X_B3(str{3'f4_D4'K_4'L_05'L_Y5/K 0aa1*aa208aXa#1*8aXa23L aX%KY 5111v1j1^0L0aag 111v1j1^*0aa4!5! 65$@a%x 561@3a% 11111%4!+16!5O63$a% 5m61@5$a%1@ 566P̘a\a11n1b11z*̘a\a44\!6!6!6*ܖaaipXo _.yL_La|a7 #buf{:7,fmt!-%4Jxi_ 787(  U97L' a Nq-tMH|aav[H81 VH:DUNI;WP:HA%intGIJHxx88rI xx8H 8^ |I< jI# I8# IK# 4I# I8# IK# msg# +# H# ]I#$ cIx#( =Iq#, H#0 IK#4 JK#8j %I ?q#TINM3 EO4  _q# 'K# XMq# osq# <# N8# jO8# # N8# ?M#$ O8#( 'q#, ,q#0oN9N! SK op1#M1#val'#TNMO[O3NLOSMMNNML _M jN M >O +O~N6O{MLENNoMMMLITtOGMMBADMEMVO,LEND %N!PNҷ D}lowDi> OD},"ECx> X~ }< <~ }8!endq}$ - @ 1  dO a QO a N ta M 4a'xD '' %J' %J  ' %J  $Lqaa> zO'>"+$Lqaa>w zO'?MqK?7w i?Oq|?+ ?} j&]NEqaa] zOF'?7Gw ?OHq?$&Mqa -aarf*aaW-aas .)aH'v!`'"6"A"L) aLa * aLa""/n&QHLaaW ,2W]P1%a$aPWD i3H0r+4D 0Q5T h nT y1d y+5w- TO$a4a^ PSintUKu32%O'TdAT $a4a|WT P 8T""T T#OW i$H $ax'& 'num3OWsel4OW 5HXddox-TO4aa PSintUKu32%O> [OE\,T{Td# val d#T($a%d# pad&# tmr'"#wT(d# T)d#$ d" o 2 o TY 24apa]T`paa]tnowbRTqaa]2aas)va$aXXv3XT{$a4a]t{P+4aa],rT,PqQXTRTHaa]f]TOoX2a'STVxbTWtbgT,xb$ y-$aaՂ P  %SintfeUKu8%u16"3u32%e0,%1,> [eE\,J jAh lZ ~% X# 8# (PU cnt,# 8# (U# e lmb ># J #P. 1(/# 80# ' (S# ),# *# 9+# ,# 1 # 0 2 &@ &# '# '# '# '# '# x&# c&# '# v%# %# $#  &A $ 1(# end# W&# %# _A# WA# BI# os# (&,Ɋ *'ϊ# $# %#D os#H ep#` '#d %(#h :%#l '#p !(#t '#x '#| kbd# (S#+S#lmbe#0$ $$+ bd%# f4&,# &,',# (,# ),# *,# +,# V,,# jt6+# 7 UVe 8W# tagX# @V ^ f4_# `# Va# Ug 8h# 1(i# 2V oL xpz# yqz# Ur# TVsz# Utz# Vu# Uvz# &Vwz# Vx# U ~ f4# 8# 1(# U 1(# 8# U low# U# iV rev# VU _V# V# V# U# V# V# vVz# Vz# Wz# Vz# Vz# Vz# Vz# yUz# U U#  U 1 )UÏ# Wď# :Uz# %Wz# IVL U͏#DVememԜ6VULU׃UجmVZUUUMV1tag  hdr<# uL#V bdT. bdiScUZ bdVpV bdʐ'!(U bdGU;SaaX &;SX#;SXp8;;Xw(; X bd=Ts>!U?S["V@ #VCY$Xa']P % $ pa(et % &(('$ $. aP(h %E %; &p('P (Z aal %| %q %g ) a$aq% * +S+S+ !!8 |b,gd X" -1{->Waa" PSintUKFWaa]0W,P7W,Q9|-aWaaZ PSintfZUKh lOS@ZvalBZnWi HSG valGZxW& W&reg(W0% W0reg2 WJaa!Y aaLaaRa(+(@Yaa*aa aa, RWOa@axY[ a8aQa8aRa(5 (Ya a4Ca a 0a8a6WTH@aPa] @aHaV@aHaY wWjPaaY5 TaalTaaRTa(+)Z`ada*`ada aa, Woaa9Z aaqaaRa )58)XZaa4aa aa6WtHaa] aavaaZs}-Wa ax PSintUKt $./n##0H##1H#cmd3# 84n#n96n#8:?# H   H H {n H? H  t H  #>{E i**Ha aZ $$*PZ &*HZ #*HZ p8*Z !~-3X=X aaۅPintOU1(  z SfOK0(-]6DSzUOV(eJ joh lNo MQ1(N#=FO#P#rz\s#=Ft#@H|}#~###  %? Q %'#D##|# 0- mtd."# 2# len3#<4# '5#"F6# dev7#8# 9:# 3:#$+;#(EC<4#, ."BIv#f4w#8x# ~####4# Z/#$E?#(/#,E#0N`#4w$#8#<-#@*$#D$#HJ#L"J#Pp#T2#X`p#\#`#dfŐ#hѢ#l#pW#t#x٢#|Y#H##/#3##/##M#  44 ' (e?\A# B#C#D# (Q 1U j.Fk# lenl#m#fn# o#p#q.#r.#  :V z @/`"4 K/"    f " /"  /"  /D"D  */j"j  P/" v " /" /" /" m ""fF=WS" aa]mtdS"[numS/7[retU"J[iV/errV/WhXaa]mtd"[c/X2/aa[mtd2"[ret4/[W/aa[, mtd"\i/4\!Xt"aaG\ t4f\iv/Terrv/mtdw"\W " % W b-Xa4a, P  %Sk3intfpUKu16"30,p1,-6S%UpV,E\,eeJ jAh leNo~;  Mz 1(N%# =FO%# P%# r \s%# =Ft%# @H| }%# ~# %# # % ? z   P %# D%# %# |%# 0-mtd.K# 2%#len3%# <4%# '5# "F6#dev7# 8# 9c# 3:#$ +;#( EC<]#, .K BIv# f4w# 8x0# ~# # # # ]# Z^#$ Eh#( ^#, n#0 N#4 w$#8 #< -#@ *E#D E#H k#L "k#P #T 2#X `‘#\ #` #d fű#h #l #p W#t #x #| Y# H#  # ^# 3;#  # ^# # M#]]PQ e? \A%# B# C# D# ,Q 1U  jW Fk#lenl# m# fn# o# p%# qW# rW#ci^K]t^K=K^ K ^:K:@^eKeK^KCq^KK^K0^K^Km W$1 42^# W3# 14^# 5^# 76#len7^# 8^# 9^# " :W# ^  ^K^& ~ t&4O   D  #  ; r;#Y s;#  u#I v#  w#N x#{ y#Y! z# #y {# H |#$E }"#( #, C#0 ^#4{ # #8w #<{ #@* #Dc ^#H4 p#L ^#P ^#Tw ^#X ^#\ ^#`! ,#dn ^#hF ^#l ^#ps #t ^#x+ ^#| W#N #E h#ecc  # #G! ) #ops #bbt W# # #T #3 ;#D XH  F  # ^#8 ^# ^# zF ^#y ^# ^#H h# # # ' N #$ s #(;  #,  #0*  #4  #8*  #< #@" "##D# K^ ^C KC WI ) ^s KWWWT ^ K W^y  K C  ^ K %%W ^K ^^ ^#K ^  0g 1g#E 2g# 3w# w KKKC ^KW^^KC ^"K^p CKp^^(^^K I^K ^^^d^K C ^^^) )&# 4d' =Fe# \f# 5g^# s5h^# BYj^#4n X sw & uS# Y vS# l we# Y xe#Y0PT2^2ofs2G(^(ofs(len(buf( -^,-ofs-len-buf- 3Y8^aa]pmtd8K\ofs8Q 8^R!oXaa\"\"\\"=F]#sXW#tYZ$YY#]%$aP)&&'X-^a aA]<"-l]"\-]"=F-]"/. ]$>0^]$Y1.^$sX2b^$[X3 ^(p)$XF^$8FG^)a)W&&&&*XalaK&&%a)=&&&&'X^ aa,_n"W_"\u_"=F_"/ _$>^_$X$`$sXX`$[X `()H$X`$dX`)xa *,& && &*aa&&*xaa& && &+YH^a4a9a,XHea,oYHa-XJ2L-NKw~-YLV.XM^/EN^a-HYO^}-YP}-WQ]}-kYR-S Z0PaaP/)Yh Cb(@*i1ret^lb(`*1nb.cY^2*.X%.Y%3a0a/)Y c'Dz-[^4aaD PSintUKu8%u16"3u32%OE\, . 1(/# 80# '. (H# ),# *4# 9+# ,# 1:# . J2J B8_ `# 2a# bH# +cH# \#e/# ]fV#$ [gl#( \h~#, ECl)#0 3m#4  %H))U[HO)OHU5Hl)\~)rZXbarYy#8Zy#^]^^5#]_;#^^5Yy#*[n#_n#[ #Z5#  yKJ^bH\cy#Zdy#T]ey#O\fy# ]iYjy#smiky#O]ly#\my# Qn#8[oy#B[py#Qq #_ry#]sy#W[t #eucuy#(_v #Zw1 #\[xA #YyQ #Zzy#]{y#a[|a #pxc}y#[~y#]y#f[r #\y#I]y#<]y#sdcy#C\ #[y#]y#ps0y#tqcy#[y#ps1y#RZy#k[ #icy#icey#pimy#=[y#p[r #B]y#u[y#[y#]y#  ]y# _y# ^ # ~]y# ^ # DZy#  ^ # [\y# G[y# ]y# Zy# [y# ^ # ^ # T^y# rqcy# 7^< # ^B # YR # ^b # tqxr #[y#%^ #p\y#+^;#x\y#1^r #j]y# [y#]y#c^y#tsy#i^ #Y # Y #!D^ #(^ #*V\Q #,o^ #,Zy# d o d  d  d1 K A  dQ O ya  dr g d  y  d  d # d  d   7Z< Yy#\n#_n#[ #Z< #  dR 7 < b  dr  K  d + y  d  y ? d Z \Z\\]ZZ5 ]\[hZzZa\  win #%Z #Rn#Jy# \y#8y#~WH#^n#d\P8 dev[#mT8 #8^< #<+]5#@Z5#Dz[ #HZ] #L_<H mT<8 ^Z<dw]=H]?y^@y\AyY 3[ N[yy[ mT8 y^ \y5 !^w) =^w) Zy5"izH Z\ mT8 u^5 #iH![ mT8 Z H$[d4aac%mTd8 9c%d Lc&\fy_c&\gyrc'> haaq(h )\ c(P *haa+t c, , -\Ha,a].dev)c=^) /mT8 S0 aa( *aa+ c' aa( *aa+ c1)\cH,axadk.biscU0d/=^e) W"devf)o0gH2shZ/^ik\3[,a3 \$a3#[a3"\a47b d{ 5{6]|HxaDaNd<7P|md74]|dd7^|dd7-@|nd#dev~) =^) 8mT8 d8]y$e8[^yXe47Lb L 5<6Y0HDahake7P0e74]0de7^0de7-@0e#dev2) =^3) 8mT48 f8]5yWf8[^6yf47bn  59["Hha$af.dev")f&=^$) g/Z%5T&Y&yg&[^'yg47b  59]H$aagM.dev)g%]O"h% ZHah=^) /mT8 V/^< T:ph&Yyh47Mb5;,ZHaah.dev)i&=^) $i/mT8 U"iH< a*( =*+ Bi, a +( ( =8++ `i>\ aP+(j =h+,v '-._HaaPintU SfDKh lgNoy6_aasi$n$iXi remVW bTU resi dBj U Qd-A_HaaintUP Sf,K_X buf #M #in# g 3 g 3 Y 3? ]_+ buf+ G_+,t-gY U_;2 ctx;2_aDaZjbufPinjagjbgkcgwldg[mggi_KDaaJnyctxK2inbufKynlenK,ntMgnaaKp[ oaac+oaa aoa-S_aa PSintUK_<i>,_&HaaKquaa6 aa ň-_aa= PSintUK_Haajq_Hq|aa/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/arm/lib1funcs.asm/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/build.i686-linux.arm-mucross-linux-gnueabi/arm-mucross-linux-gnueabi/libgccGNU AS 2.202aa/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/arm/lib1funcs.asm/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/build.i686-linux.arm-mucross-linux-gnueabi/arm-mucross-linux-gnueabi/libgccGNU AS 2.20Faa/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/arm/lib1funcs.asm/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/build.i686-linux.arm-mucross-linux-gnueabi/arm-mucross-linux-gnueabi/libgccGNU AS 2.20Zaa/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/libgcc/../gcc/config/arm/lib1funcs.asm/disk/d1/oe/buildbot/mucross_armv5te_incremental/build/tmp/work/i686-armv5te-sdk-mucross-linux-gnueabi/gcc-cross-sdk-4.4.2-r0.1/gcc-4.4.2/build.i686-linux.arm-mucross-linux-gnueabi/arm-mucross-linux-gnueabi/libgccGNU AS 2.20%% $ > $ > $ >  I: ; I  : ;  : ; I8  : ;  < I !I/  : ; I8 ' I.? : ; ' @ .? : ;' @ .: ; ' I@4: ; I4: ; I.: ; ' I@4: ; I .? : ;' @4: ;I4: ;I4: ; I?  4: ; I? < 4: ;I? < 4: ; I?  5I&I% $ > $ > $ >  : ;  : ; I8 I!I/ .? : ; ' @ .? : ; ' I@ .? : ; ' @ : ; I 4: ; I4: ; I  I&I.? : ; ' @.? : ; ' @% : ; I$ > $ > : ; I$ >  I  : ;  : ; I8  : ;  < I!I/  : ; ( ' II5' .: ;' I : ;I&I.: ; ' I@ : ; I.? : ; ' I@ .? : ; ' I@ : ; I4: ; I4: ; I4: ; I .? : ;' @!.? : ;' I@": ;I#.? : ;' I@$.? : ;' I@ %.? : ; ' I@&.? : ;' @'4: ;I (4: ;I )4: ;I*4: ;I+ U,4: ;I-4: ; I..? : ; ' @/1X Y 0111X Y24: ; I 3: ;I44: ;I54: ;I? < % : ; I$ > $ > : ; I$ >  I  : ;  : ; I8  : ;  < I!I/  : ; I8 ' I' 5!I : ; : ;I8  : ;I8  : ; : ;I : ;: ;I : ;( ( .? : ;' I  : ;I!4: ;I"4: ;I#.: ; ' I $: ; I%.: ;' I &: ;I'.: ;' (.? : ;' ).: ;' *.: ;' @ +.: ;' @ ,: ;I -: ;I ..1@ /1 0.? : ;' I@ 1: ;I21X Y314 541641718.? : ;' @ 9.? : ;' I@:4: ;I;4: ;I < =.? : ;' @>.? : ;' I@?: ;I@1X YA5IB.? : ; ' @C4: ; ID4: ; IE1X Y F1RUX Y G.: ;' @H.: ;' @I41 J1RUX YK4: ;IL : ;M N UO UP 1Q1RUX YR4: ; I S4: ;I T4: ; I? < U4: ; I?  V4: ; I?  W!I/% : ; I$ > $ > $ >  II!I/  : ;  : ; I8 : ; I8  : ;  : ; I!I/ : ; .: ; ' I : ; I: ; I4: ; I.: ; ' I@: ; I4: ; I: ; I4: ; I4: ; I .: ;' I@: ;I: ;I4: ;I .: ; ' @4: ; I 4: ; I!4: ;I".: ;' @#4: ;I$4: ;I%.: ;' @ &.? : ;' @'1X Y(1) *41+ ,4: ;I- U..: ;' @/1RUX Y04114: ; I? < 24: ;I? < 35I% : ; I$ > $ > $ >  II!I/  : ;  : ; I8 !I .? : ; ' @ 4: ; I4: ; I4: ; I5I.: ; ' @: ; I.: ; ' @4: ;I? < 4: ; I?  % : ; I$ > $ > $ >  II!I/ .: ; ' I  : ; I .: ; '  : ; I 4: ; I.: ; ' @4: ; I4: ; I1X Y 15I.? : ;' @4: ;I U4: ;I 4: ;I.: ;' @.: ;' @: ;I: ;I4: ;I1X Y 1RUX Y! U"41#4: ; I $4: ; I? < %4: ;I? < &4: ; I?  % : ; I$ > $ > : ; I$ >  I 5  : ;  : ; I8 I !I/  : ; !I/ : ; ( .: ; ' I : ; I&I.: ;' : ;I: ;I: ; I4: ; I4: ; I.: ;' I .: ;' I@: ;I: ;I4: ;I 4: ;I! "4: ;I# $.? : ;' @%4: ;I&4: ;I '1RUX Y(1) U*1 +1RUX Y,5I-.? : ;' @ ..: ;' @/.: ;' @04: ;I 11X Y2.: ; ' 34141RUX Y 5416171X Y8 U91X Y :1RUX Y ;1X Y <4: ;I? < =4: ; I? < >4: ; I?  % $ > : ; I$ > : ; I$ >   : ;  : ; I8  : ;  <  I I!I/  : ; I8  : ; ' I : ; ( &I' I : ;I8  : ;I8  : ;!I/.: ; ' : ; I: ; I4: ; I4: ; I .? : ; ' @!1RUX Y "1# U$41%4: ; I &4: ; I '4: ; I?  (4: ; I?  )5I% $ > : ; I$ > : ; I$ >  I &  : ;  : ; I8  : ;  I!I/  : ; (  : ; I8 ' I&I' I<  : ;I8  : ;I8  : ;!I/ : ;.: ;' I : ;I: ;I.: ; ' I  : ; I!.: ;' ": ; I#.: ; ' @$: ; I%4: ; I&.: ; ' I@ ': ; I (4: ;I )4: ;I *.: ;' @ +: ;I,: ;I -.: ;' I@.4: ;I/4: ;I0.: ;' @1: ;I24: ;I34: ;I41X Y516 U7 8 U9.: ;' I@ :.? : ;' @;.? : ;' I@<4I4  =: ; I>: ;I ? @ : ;A1RUX YB : ;C1RUX YD E41F41 G41H4I4 I4: ; IJ1K1X YL4: ; I M!N4: ;I? < % $ > : ; I$ > : ; I$ >   I  : ;  : ; I8  : ;  I !I/  : ; I8 ' I : ; ( &I' I<  : ;I8  : ;I8  : ;!I/.: ; ' I : ; I: ; I4: ; I.: ;' I : ;I : ;I!4: ;I"4: ;I#.: ; ' I@$: ; I%: ; I&4: ; I '.? : ;' I@ (: ;I): ;I *4: ;I+.: ;' I@,: ;I-4: ;I .4: ;I / U04: ;I11X Y213 441 54164171X Y81RUX Y94: ; I:4: ; I ;4: ; I< U= : ;>.? : ;' I@? : ;@.: ;' @A : ;B1RUX YC 1% $ > : ; I$ > $ >   I : ;  : ; I8  : ;  I !I/ : ; I8 ' I : ; ( &I' I< .: ; ' I : ; I4: ; I.? : ; ' I@: ; I: ; I 4: ; I4: ; I 4: ; I4: ; I: ; I : ; I!1X Y "1# $41% $ > $ > $ >  I : ; : ;I8  : ;I8 I !I/ 4: ; I?  % $ > : ; I$ > : ; I$ >   I  : ;  : ; I8  : ;  I !I/  : ; I8 ' I : ; ( &I' I<  : ;I8  : ;I8  : ;!I/.: ; ' @ : ; I : ; I: ; I4: ; I4: ; I .? : ; ' @ !: ; I ".? : ; ' I@ #4: ; I % $ > $ > $ > : ; I  : ;  : ; I8  : ;  <  I I !I/  : ; I8 5I.: ; ' I : ; I.? : ; ' @: ; I4: ; I1RUX Y 1&I.? : ;' @ .? : ; ' I@ .? : ;' I@ .? : ; ' I@.? : ; ' @ : ; I.? : ;' @ : ;I 4: ; I !4: ; I?  "5I%  : ;  : ; I8  : ; I8 $ > I!I/ $ > : ; I  I 5I .? : ; ' @ : ; I : ; I$ > .? : ; ' @ : ; I .? : ; ' I@ .? : ; ' I@ % $ > $ > $ >  I: ; I  : ;  : ; I8  : ;  < I !I/  : ; I8 ' II.: ;' : ;I&I: ;I4: ;I4: ;I.? : ;' I@: ;I4: ;I 1X Y11RUX Y U41 41 1X Y!4: ; I?  "5I#4: ;I?  % $ > $ > $ >  I: ; I : ;  : ; I8 : ; I8 ' I I .? : ; ' I@ : ; I4: ; I4: ; I4: ; I?  % $ > : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ;  : ;  : ; ' II : ;  : ;I8  : ;I8 : ;I!I/.: ;' I .: ;' I : ;I&I: ;I.: ; ' I : ; I4: ;I4: ;I .? : ; ' @ !: ; I ".? : ; ' @ #.: ;' I@$: ;I%' &4: ;I '4: ;I(4: ;I) *1X Y+1,.? : ;' I@-4: ;I .: ;I /.: ; ' I@0: ; I14: ; I24: ; I31RUX Y 4 U54164171RUX Y81X Y91X Y : ; < U=1RUX Y>41 ?4: ; I @4: ; I?  A!B4: ; I? < C4: ; I?  D5IE4: ;I?  % $ > $ > $ >  I & : ;  : ; I8 : ; I8 ' I I : ; II!I/ ' I' &I.: ; ' : ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I 4: ; I  4: ; I&I!4: ; I? < 4: ; I?  % $ > $ > $ > : ; I I : ;  : ; I8 : ; I8 ' I I .: ; ' I  : ; I4: ; I.: ; ' I@: ; I4: ; I .? : ; ' I@: ; I4: ; I1RUX Y 1 U411RUX Y 41 4: ; II!I/ 4: ; I?  % $ > $ > $ >  I: ; I  : ;  : ; I8  : ;  < I !I/  : ; I8 ' II!I/'  : ; ( .: ;' .? : ;' I : ;I: ;I4: ;I.? : ;' .: ;' .: ; ' I : ; I4: ; I.1@  1!41".: ;' @ #.: ;' @ $: ;I %.? : ;' @&1RUX Y'.? : ;' @(: ;I)1RUX Y*1+4: ;I,: ;I-1X Y.1X Y/ 041 1.: ;' I@24: ;I 34: ;I 44: ;I5.: ;' I@6.: ;' I 74: ;I8 : ;9.? : ;' I@: U;1RUX Y<41= 1>.: ; ' I@?: ; I@4: ; I A4: ; IB4: ; I C1RUX Y D.? : ; ' I@E4: ; IF4: ; I? < G4: ; I?  H5II4: ;I?  J' % $ > 5I$ > $ >  I: ; I : ;  : ; I8 : ; I8 ' I I .? : ;' I@: ;I4: ;I4: ;I4: ;I4: ;I4: ;I  U  U.? : ; ' I@: ; I4: ; I 4: ; I.: ;' I@4: ; I4: ; I?  I! 4: ;I? < !4: ;I?  % $ > $ > $ >  I: ; I : ;  : ; I8 : ; I8 ' I I .? : ; ' I@ : ; I4: ; I 4: ; I?  % $ > : ; I$ > : ; I$ >  I &  : ;  : ; I8 : ; I8 ' II : ; I!I/ '  : ; ( &I< .: ; ' : ; I: ; I.: ; ' I &I.: ;' I : ;I: ;I4: ;I !4: ;I".: ;' # : ;$ %.: ;' I@&: ;I': ;I(4: ;I)4: ;I* U+.: ; ' @,4: ; I -4: ; I.4: ; I/4: ; I0.: ; ' @ 1: ; I2: ; I3.: ;' @44: ;I 51X Y617 U81RUX Y91RUX Y :1RUX Y;1X Y<1X Y =.: ; ' I@>4: ; I?.? : ;' I@@4: ;I A41B41C41 D 1E F.1@G.: ;' I@H I 1J4: ; I K!I/L!M4: ; I? < N4: ; I?  O4: ;I?  % $ > : ; I$ > : ; I$ >  I  : ;  : ; I8 : ; I8 ' I II!I/  : ; '  : ; ( &I<  : ;I8  : ;I8  : ;!I/.: ; ' I : ; I.: ;' I : ;I.: ;' I : ; I .: ; ' @!: ; I"4: ; I #.: ;' I@$: ;I%: ;I&4: ;I'4: ;I(1X Y)1*1X Y+ U,4: ;I -.: ; ' I@.: ; I/4: ; I04: ; I14: ; I24: ; I 3.? : ;' I@44: ;I5 : ;6 741 8 : ; 91RUX Y :41;1X Y <1X Y =.? : ; ' I@>4: ; I?1RUX Y@ UA4: ;I B4: ; I? < C!D4: ;I?  % $ > $ > $ >  I: ; I : ;  : ; I8 : ; I8 ' I I  : ; ( ( : ;I.? : ; ' I@: ; I.: ; ' 4: ; II!I/ .: ; ' I@4: ; I4: ; I1RUX Y  U41  4: ; I .? : ; ' I@ 4: ; I? < 4: ;I? < !4: ; I?  "4: ;I?  % : ; I$ > $ > $ >  I  : ;  : ; I8  : ;   : ;  : ; I8 I!I/ ' II!I/.: ; ' I : ; I.? : ; ' I@ .? : ;' I@: ;I: ;I4: ;I4: ;I  U4: ;I.? : ; ' I@: ; I4: ; I4: ; I 4: ; I!4: ; I " #4: ;I$ %4: ;I&4: ;I '.: ; ' I@(4: ; I )&I*4: ; I? < +4: ;I? < ,4: ; I?  -5I.4: ;I?  % $ > : ; I$ > $ >  I : ;  : ; I8 : ; I8 ' I I I !I/ .: ;' I .: ;' I : ;I&I.: ; ' I : ; I: ;I.? : ; ' I@: ; I4: ; I4: ; I4: ; I1X Y 11X Y U4: ; I4: ; I .: ; ' I@!4: ; I?  "4: ;I?  % $ > : ; I$ > $ >  I : ;  : ; I8 : ; I8 ' I I I !I/ .: ;' I : ;I&I.: ; ' I : ; I: ;I.? : ; ' I@: ; I4: ; I 4: ; I4: ; I4: ; I4: ; I1X Y 11X Y4: ; I? < 4: ; I?  % $ > $ > $ >  I : ;  : ; I8  : ; I8 ' I I : ; I I !I/.: ;' I : ;I: ;I4: ;I4: ;I.: ;' &I.? : ;' I@: ;I: ;I.? : ; ' I@: ; I4: ; I 4: ; I  U4: ; I.? : ;' I@ 4: ;I 4: ;I!4: ;I"4: ;I #.? : ;' @$1X Y%1& '41(1X Y)41 *4: ; I+4: ; I, U-!I.1RUX Y/104111RUX Y2!I/ 34: ; I? < 4!54: ; I?  64: ;I?  % $ > $ > $ >  I: ; I  I8 4  &  : ;  : ; I8  : ; < I!I/  : ; I8 ' I' I&I : ; ( .: ; ' I : ; I.: ; ' : ; I.: ; ' I@: ; I: ; I4: ; I .? : ; ' I@!1X Y "1#.? : ;' I@$: ;I%1X Y&.? : ;' @': ;I(.? : ;' I@ )4: ;I *.? : ;' I@ +.? : ;' @ ,.? : ;' @-: ;I ./4: ;I04: ;I14: ;I2!I/3.? : ;' @ 4.? : ;' @5 64: ;I7&I8.? : ; ' @9: ; I :4: ; I ;4: ; I<.? : ;' I@=!>4: ; I? < ?4: ; I?  @5I% $ > $ > $ > : ; I I  : ;  : ; I8  : ;  < I !I/  : ; I8  : ; : ;I8  : ;I8 : ;I.? : ;' I : ;I4: ;I.? : ;' @ .1@ 141 41.? : ;' I@: ;I4: ;I4: ;I1RUX Y 1! U"41#1RUX Y$.? : ;' @%4: ;I&.: ;' ': ;I(: ;I)1 *4: ;I +.? : ;' I@ ,: ;I - : ;. U/ 0 14: ;I 2!I/34: ;I 4&I54: ;I?  64: ;I?  75I% : ; I$ > $ > $ >  I  : ;  : ; I8  : ;   : ;  : ; I8 I!I/ !I/.? : ; ' I : ; I.: ; ' I 4: ; I.1@ 1.? : ; ' I@ : ; I4: ; I1X Y 11RUX Y  U41.? : ;' I@: ;I : ;I!4: ;I"4: ;I #4: ;I$4: ;I %4: ;I&1X Y'&I(.? : ; ' @)4: ; I?  *5I+4: ; I? < ,!I/-4: ; I?  % : ; I$ > $ > $ >  I  : ;  : ; I8  : ;   : ;  : ; I8 I!I/ !I/ : ; ' I : ; ( &I' I< .: ; ' I : ; I: ; I.? : ; ' I@ : ; I.? : ; ' I@ .? : ; ' I@: ; I 4: ; I !4: ; I "4: ; I#4: ; I$1RUX Y %1&1X Y '.? : ;' I@(: ;I): ;I*4: ;I +4: ;I ,4: ;I-4: ;I.1RUX Y/1X Y0.: ;' @1.? : ;' @24: ;I3!44: ; I? < 54: ; I?  64: ; I?  75I% $ > $ > $ > : ; I  : ;  : ; I8  : ;  <  I I !I/  : ; I8  : ; ( .: ; ' @ .? : ; ' I@ .? : ; ' @4: ; I4: ; I?  5I% $ > : ; I$ > $ >  I &  : ;  : ; I8 : ; I8 I !I/  : ;  : ; <  : ;  : ;I8  : ;I8 : ;I : ;.: ;' I .: ;' I : ;I&I.? : ;' I : ;I.: ; ' I : ; I.? : ; ' I 4: ; I 4: ; I!.: ;' "4: ;I#4: ;I$.1@ %1&41'41(1X Y)1*1 +1RUX Y,.? : ;' I@-: ;I..? : ;' I@ /.? : ; ' @0: ; I1: ; I 24: ; I34: ; I41RUX Y 5 U61X Y 7.? : ;' @8.? : ;' @ 9: ;I:4: ;I;.? : ; ' I@<4: ; I =1RUX Y >1X Y ?1RUX Y@1X YA4: ;IB C4: ; I?  D5I% $ > $ > $ >  I: ; I I !I/  : ;  : ; I8  : ;  <  : ; I8 ' II!I/.: ;' : ;I: ;I.: ;' I 4: ;I4: ;I.: ; ' I : ; I4: ; I 4: ; I.? : ; ' @ : ; I .? : ;' I@ : ;I!4: ;I "&I#: ;I$4: ;I%4: ;I&1RUX Y'1(1) U*41+41, -41 .4: ;I /.: ;' I@0.: ;' @1 21RUX Y31X Y4 5 U61X Y7.? : ;' I@ 8.? : ;' @94: ; I :4: ; I?  ;5I<4: ; I?  =4: ;I?  % $ > $ > : ; I$ >  I& : ;  : ; I8 ' I I .: ; '  : ; I: ; I.? : ; ' @ 1RUX Y 1.? : ; ' I@ .? : ;' I@ : ;I: ;I .? : ; ' @4: ; I 4: ; I.? : ; ' I@: ; I: ; I4: ; I4: ; I.? : ;' I@4: ;I : ;!4: ;I": ;I#: ;I $1X Y %1X Y % $ > $ > $ >  I: ; I.: ; ' I : ; I .: ; ' I@  : ; I 4: ; I 1X Y  11RUX Y .? : ; ' I@: ; I4: ; I% $ > $ > $ >  I: ; I &  : ;  : ; I8  : ;  < I!I/  : ; I8 ' I' I&I.: ; ' : ; I: ; I4: ; I.? : ; ' I@ .? : ; ' I@: ; I4: ; I 1RUX Y 11X Y 1RUX Y  U!41 ": ; I#4: ; I$ %4: ; I&&I'4: ; I?  (4: ; I?  )5I% $ > $ > $ >  I : ;  : ; I8 : ; I  : ;  : ; I8 I !I/ .: ; ' I : ; I4: ; I.: ;' 4: ;I.? : ; ' I@: ; I: ; I : ; I4: ; I4: ; I4: ; I 4: ; I 1RUX Y 1 U41 1X Y 1!.? : ;' I@ ": ;I#.? : ;' @$.? : ; ' @ %: ;I&1X Y' (41 )' I*.: ;' I@+4: ;I,4: ;I-4: ;I.1X Y/.? : ;' I@04: ;I % $ > $ > : ; I$ >  I: ; I  : ;  : ; I8  : ;  < I!I/  : ; I8 .? : ; ' @: ; I4: ; I4: ; I4I4  &I4: ; I .? : ; ' I@4: ; I4: ; I?  5I% $ > $ > $ > : ; I.? : ; ' I@: ; I: ; I 4: ; I 4: ; I  I I !I/ 4: ; I &I% $ > $ > : ; I$ > : ;I.? : ; ' I@: ; I  I &I .? : ; ' I@  : ; I I!I/ 4: ; I % I!I/ $ > $ > 4: ; I?  % $ > : ; I$ > $ >  .? : ; ' @: ; I : ; I 4: ; I 4: ; I 4: ; I  I&I.? : ; ' I@.? : ; ' I@4: ; I I!I/ !4: ; I? < % $ > $ > $ >  I : ;I' I I '   : ; : ;I8 : ;I8 .? : ; ' I@: ; I: ; I4: ; I 4: ; I4: ; I.? : ; ' @ .? : ; ' I@ 4: ; I% $ > $ > : ; I$ >  : ;  : ; I8  : ; I8 I !I/  : ;  .: ; ' I  : ; I.: ; ' : ; I4: ; I I4: ; I.: ;' I : ;I.? : ; ' I  .? : ; ' @ : ; I .: ; ' I@: ; I: ; I4: ; I4: ; I U1RUX Y 1!1X Y " #41$41 %1X Y &1'41(.? : ; ' I@ ).? : ; ' I@*.1@+1 , U-.? : ;' I@.: ;I/: ;I04: ;I 14: ;I24: ;I34: ;I 41RUX Y51X Y61X Y7: ;I 84: ;I9.? : ;' I@ % $ > $ > $ > : ; I I.? : ; ' I : ; I 4: ; I &I .? : ;' I  : ;I : ;I4: ;I4: ;I&: ; I.1@ 1 41.? : ; ' I@ : ; I: ; I : ; I .? : ; ' I@: ; I4: ; I4: ; I1RUX Y 1 U 1!41 ".1@#41$.? : ;' I@%: ;I&: ;I '4: ;I(1RUX Y)1RUX Y*4: ;I +4: ;I,1X Y- ..? : ;' I@ /: ;I 0 1: ;I21X Y31X Y 44: ; I?  5I6!74: ; I? < % : ; I  I8 4  $ > $ > $ >   I : ; I .: ; ' I  : ; I 4: ; I: ; I.: ;' I : ;I: ;I4: ;I4: ;II!I/ &I.? : ; ' I@: ; I: ; I 4: ; I: ; I.: ; ' I@4: ; I U1RUX Y  1!41".: ;' I@#: ;I$: ;I%4: ;I &4: ;I '4: ;I(4: ;I) * +.? : ;' @,: ;I -..? : ;' I@/ : ;01X Y1124131RUX Y441 51RUX Y61X Y7!84: ; I? < 94: ; I?  % : ;I$ > $ >   I' II '   : ; : ;I8 : ;I8 $ >  : ;  : ; I8  : ; I8 : ; I : ; ( (  : ; &II!I/.: ;' : ;I.? : ;' @: ;I : ;I4: ;I4: ;I 4: ;I !4: ;I "4: ;I# : ;$.? : ;' I@%!I/ &.? : ;' I@ ': ;I(4: ;I).? : ;' @ *.: ;' I +: ;I,1RUX Y-1.1RUX Y/ U04114: ;I?  % $ > $ > : ; I$ >  : ; ( .? : ; ' I@  : ; I 4: ; I 4: ; I .? : ; ' I@ % $ > $ > : ; I$ >  I: ; I : ;  : ; I8  : ;  < I !I/  : ; (  : ; I8 .? : ; ' I : ; I4: ; I.: ; ' .: ; ' I : ; I4: ; I.? : ; ' @ : ; I .1@ 141 41.? : ; ' I@1RUX Y  1! U"41#1RUX Y $: ; I%.? : ; ' I@ &.? : ;' I@'4: ;I(4: ;I)1X Y* +: ;I,4: ;I-1X Y.1RUX Y/5I04: ; I 1I% $ > $ > : ; I$ > .: ; ' I .? : ; ' @: ; I 4: ; I 4: ; I 4: ; I 1RUX Y U4: ; I II!I/ % $ > $ > : ; I$ > : ; I : ;  : ; I8 : ; I8 I !I/ .? : ; ' .1@ .? : ; ' I@ 4: ; I .? : ; ' @ 1X Y .? : ; ' I@: ; I: ; I : ; I 4: ; I4: ; I 1RUX Y 4: ; I?   I% $ > : ; I$ > : ; I$ >  I  : ;  : ; I8 : ; I8 I !I/  : ;  : ; <  : ;  : ;I8  : ;I8 : ;I : ;  : ; I : ; I.: ; ' : ; I4: ; I: ; I.: ;' : ;I.? : ; ' I@: ; I 4: ; I !4: ; I "4: ; I#4: ; I$1RUX Y %1& U'41(1X Y )1X Y *' +I,4: ; I?  -5I% $ > $ > $ > .? : ; ' @ : ; I % $ > $ > : ; I$ > .: ; ' I 4: ; I.: ; '  5I : ; I : ; I .? : ; ' @ 1X Y 1 41 1RUX Y  U411X Y 41.? : ; ' I@ .? : ; ' I@ % $ > $ > $ >  I : ;  : ; I8  : ; I8 ' I I : ; I .? : ; ' I@ : ; I% $ > $ > $ > : ; I : ;  : ; I8  : ;  I !I/ : ; I8  I ' I : ; ( &I' I < .: ; ' I : ; I.? : ; ' I@ : ; I4: ; I4: ; I : ; .? : ; ' @ .? : ; ' I@: ; I4: ; I 4: ; I?  % $ > : ; I$ > : ; I$ >   I  : ;  : ; I8  : ;  I !I/  : ; I8 ' I : ; ( &I' I<  : ;I8  : ;I8  : ;!I/.: ; ' I : ; I: ; I.: ; ' I@ : ; I: ; I : ; I !.: ;' I@": ;I#4: ;I $4: ;I%1RUX Y&1'.? : ;' I@( U)1RUX Y*1X Y+.? : ; ' I@,: ; I-4: ; I .4: ; I/4: ; I0 14: ; I2 U3 % $ > $ > : ; I$ >  I: ; I  : ;  : ; I8  : ;  < I!I/ ' II5'  : ; : ;I8  : ;I8  : ;!I/!I/ : ;( .: ;' I : ;I4: ;I.: ; ' : ; I 4: ; I!.: ;' "4: ;I#4: ; I$.? : ;' @%: ;I&4: ;I'1X Y(1)1* +41,41-.: ;' I@ .: ;I/4: ;I 01X Y1.? : ;' I@24: ;I 3 : ;44I4  5&I6.: ; ' I@7: ; I84: ; I9.: ;' I@:4: ;I;.: ;' I@<1RUX Y= U>1RUX Y% $ > $ > $ > : ; I.? : ; ' I@: ; I: ; I 4: ; I 4: ; I 4: ; I  I% $ > $ > $ > : ; I : ;  : ; I8  : ; I8 I !I/ .: ; '  : ; I : ; I4: ; I I.: ; ' @: ; I : ; I4: ; I&I 1X Y 11 41: ; I4: ; I1X Y .? : ;' @: ;I : ;I!4: ;I "1RUX Y#.? : ;' @% $ > $ > $ > .: ; ' 4: ; I.? : ; ' I@1X Y  41% $ > $ > $ > .? : ; ' I@: ; I%%%%`xN`D{`d(`@ `Y'4&`T26`+5(8`9?`, CFK`X L`9O`F` l`h`x>```x` `U`  `\` `xh`"`3d`MLaxS a\HadaaxVf$a0 qT"a,|'a$:amaD+>aLD+?aHH  | ,?a ,?a(,?aD    | -@a, -@aL -AaH -PAaX -AaX -BaX -XBa -\Ba-dBa\H -Ba -Ba -Ba -Ca - Ca4-TCaH-Da,D -HDa-LDa4D-Da4D-Da$D-DahD DP-@Ea`H$-EaD P((-HaDD(   | D/\KaD/`KaD,D/LaPD    H$D/XPaH$D/PaD $D/QaD ,D/Ra H HH    D/\\a $D/h\aD | 0^a 0^a 04^a0<^alD(0^aD   (0@_aD   0_aD D0|`aD D$0 aaDD  (0aaDD(  0lba`D(0baD    | (2ca|$(24daD L( | p2fa p2faPDp2aD     | >a | >aHD>aHD >@a>PaHD>aHD >a | $?a0D | P? a P?a,P?aPLP?apHP?alD | ?a(?aD   ,?aD    H0,? aD    \0,?adD D    | @4alD @a,@,aLD H0   @xaD@Da$D@haD$@$aH$@aH | (AapD     | ( Ba, D   DX( BDa<H    Ba@H Ba|H Dh Beth_initeth_initialize @wNetSetHandlerNetCksumOkNetCksum2copy_filenamewstring_to_VLANgetenv_VLANstring_to_ipf getenv_IPaddr NetEthHdrSize VLAN_to_string# ip_to_stringp random_port NetSetTimeout NetSetEther NetSendPacket ArpRequest NetStartAgain ArpTimeoutCheck NetSetIPNetSendUDPPacketKPingSendNetLoopXNetReceive;NetOurGatewayIPMNetOurSubnetMask_NetOurDNSIPNetOurNISDomainNetOurHostNameNetOurRootPathNetBootFileSizeNetBootFileXferSizeNetOurEtherNetServerEtherNetOurIPNetServerIP#NetTxPacketENetRxPacketsWNetRxPacketiNetRxPacketLen{NetIPIDNetBcastAddrNetEtherNullAddrNetOurVLANNetOurNativeVLANNetStateNetRestartWrapBootFile NetPingIP7gd`PktBufwNetArpWaitPacketIPNetArpWaitReplyIPNetArpWaitPacketMACNetArpWaitTxPacketNetArpWaitTxPacketSizeNetArpWaitPacketBufNetArpWaitTimerStartNetArpWaitTryY' xNfsStart*2Q4RarpRequest>RarpTryO+5TftpStartTftpRRQTimeoutMSecsTftpRRQTimeoutCountMax~9P BootpRequestDhcpRequest BootpID BootpTry dhcp_state+ dhcp_leasetime= NetDHCPServerIPFCFSnand_initCnand_curr_deviceenand_infowgd|X|4 nand_release!nand_scan_tail)nand_erase_nand+nand_wait_ready2nand_scan_ident3nand_scan\Onand_isbad_bbtnand_update_bbt+nand_scan_bbtnand_default_bbt;F -nand_calculate_eccnand_correct_data4Rnand_flash_ids?nand_manuf_ids:lvkw_nand_select_chipboard_nand_inithS_serial_setbrgserial_setbrg_serial_tstcserial_tstc_serial_getc%serial_getc=_serial_putc_rawvserial_putc_raw_serial_putcserial_putc_serial_puts2serial_putsYserial_initgde>NS16550_initNS16550_reinit NS16550_putc@NS16550_getckNS16550_tstc;%do_bdinfogd__u_boot_cmd_bdinfoRrado_go_execdo_goM__u_boot_cmd_go___u_boot_cmd_reset" __board_lmb_reserveF __arch_lmb_reservek __arch_preboot_osm do_iminfo do_bootddo_bootm_subcommanddo_bootmload_addr'gdOboot_osqcmd_bootm_sub__u_boot_cmd_bootm__u_boot_cmd_boot__u_boot_cmd_bootd__u_boot_cmd_iminfo6do_coninfo__u_boot_cmd_coninfoOUbinary_testdo_itest~op_table__u_boot_cmd_itestdktranschk1k_data_initk_data_save>k_data_restorebk_data_charsend_pads1_sendpackethandle_send_packetsend_nacksend_ackdo_load_serial_bin do_load_serialR gdj his_eol} his_pad_count his_pad_char his_quote os_data_init os_data_charsend_parmssend_ptr*__u_boot_cmd_loads=__u_boot_cmd_loadbP__u_boot_cmd_loady\4 do_mem_crc(do_mem_basedo_mem_mtestdo_mem_loopdo_mem_cpdo_mem_cmpXdo_mem_mwdo_mem_nmdo_mem_mm^do_mem_md dp_last_addr dp_last_size& dp_last_length8 mm_last_addrJ mm_last_sizeu __u_boot_cmd_md __u_boot_cmd_mm __u_boot_cmd_nm __u_boot_cmd_mw __u_boot_cmd_cp __u_boot_cmd_cmp __u_boot_cmd_crc32 __u_boot_cmd_base __u_boot_cmd_loop __u_boot_cmd_mtest2ado_sleep__u_boot_cmd_sleepx"mtd_id_parsefind_dev_and_partmtd_device_validate@mtdparts_init#do_chpart do_mtdpartsy"mtdids"devices"current_mtd_dev"current_mtd_partnum"__u_boot_cmd_chpart"__u_boot_cmd_mtdpartsW`3xdo_nandbootdo_nandQ__u_boot_cmd_nandd__u_boot_cmd_nbootMdo_ping/do_nfsdo_dhcpdo_rarpb7do_tftpbdo_bootp__u_boot_cmd_bootp__u_boot_cmd_tftpboot__u_boot_cmd_rarpboot__u_boot_cmd_dhcp__u_boot_cmd_nfs __u_boot_cmd_pingS+get_env_idBenvmatchgetenv_rdo_saveenvmgetenv_do_setenv#do_setenvsetenv\do_printenvIgdo__u_boot_cmd_saveenv__u_boot_cmd_printenv__u_boot_cmd_setenv__u_boot_cmd_runX\E>sourceIdo_source__u_boot_cmd_source1__u_boot_cmd_autoscr:a_0do_imgextractL__u_boot_cmd_imxtract)VfR Gcmd_get_data_sizedo_echo"cmd_usageQdo_versionvar_completeGfind_cmd_tblfind_cmdinstall_auto_complete_do_helpdo_help2cmd_auto_complete __u_boot_cmd_version __u_boot_cmd_echo+ __u_boot_cmd_help> __u_boot_cmd_question_markCq fgetcftstcYfputcfputsdisable_ctrlc<had_ctrlcTclear_ctrlchdbgconsole_init_fsearch_deviceconsole_assignYfprintfputsvprintfJprintfstdio_print_current_devicesconsole_init_rR serial_printf putc tstc getc ctrlck gd,|l Cmalloc_bin_relocvsbrkmalloc_trimnfree5cfreemallocmemalignnpvallocvallocmalloc_usable_size malloptJ calloc mem_malloc_initJ realloc mem_malloc_start, mem_malloc_end? mem_malloc_brkR gdenv_get_char_memoryenv_get_addrenv_get_charSenv_completeGenv_crc_update\set_default_envqenv_relocategddefault_environmentms env_get_char_spec env_init writeenv readenv env_relocate_spec saveenv0 env_name_specB env_ptrZ gd8get_versionjumptable_initgd(˞ image_multi_count get_table_entry_name genimg_get_os_name* genimg_get_arch_nameo genimg_get_type_name genimg_get_comp_name genimg_get_image genimg_has_config8 get_table_entry_id genimg_get_comp_id genimg_get_type_id genimg_get_arch_id genimg_get_os_idE genimg_get_format image_multi_getimg genimg_print_size memmove_wdgetenv_bootm_sizeNgetenv_bootm_lowgetenv_yesnoimage_check_hcrcjimage_check_dcrcimage_print_contents>boot_get_ramdisklgdP __show_boot_progressparse_linerun_command{do_run readline_into_buffer readline main_loop gd* console_buffer< hist_num_ hist_list hist_linesmiiphy_initmiiphy_get_current_devmiiphy_is_1000base_xSmiiphy_listdevmiiphy_writemiiphy_readmiiphy_duplexmiiphy_speed}miiphy_resetmiiphy_infovmiiphy_set_current_devmiiphy_registersrec_decodeEstdio_get_liststdio_clonestdio_registercstdio_initstdio_get_by_nameIstdio_deviceskstdio_names}gdparse_numxyzModem_errorxyzModem_stream_closeCYGACC_COMM_IF_PUTCCYGACC_COMM_IF_GETC_TIMEOUTfxyzModem_stream_terminatexyzModem_stream_read@xyzModem_stream_openXmv_phy_88e1118_initareset_phydram_initboard_initgd cyg_crc167crc32crc32_no_compPcrc32_wdR?_ctypeBWprint_sizeGdisplay_options`print_buffer9PTzunzipgunzipdzfreezallocCA lmb_dump_all<lmb_initlmb_add2lmb_freelmb_reserveAlmb_overlaps_region__lmb_alloc_base+lmb_is_reservedlmb_alloc_baselmb_alloc, strcpystrncpyestrcatstrncatstrcmp?strncmpstrchrstrrchr,strlenPstrnlenstrspnstrpbrkstrtokstrsepMstrswabmemsetbcopyImemcpymemmove memcmpKmemscanstrstr memchr strdupg ___strtoko ,simple_strtoulsimple_strtolustrtoulpanicvsprintfu sprintf hex_asc#inflate_fast`inflate_table inflateReset inflateInit2_ inflateInit_ inflateEnd adler32~ zcfree zcallocb inflatez_errmsg/,kw_sdram_barkw_sdram_bsa Vreset_cpukw_winctrl_calcsizekw_config_adr_windowskw_config_gpio1kw_config_mpparch_cpu_initcpu_eth_initJarch_misc_initprint_cpuinfo get_random_hex$S/kirkwood_mpp_conf<reset_timer_maskedKget_timer_maskedtreset_timerget_timerset_timerudelay,timer_initkwtmr_regs(# ( do_bootm_linux gdK+uflush_cache|+ %icache_enableicache_disable[icache_statusdcache_enable5dcache_disabledcache_status/Vdo_reset~1 "get_mtd_deviceput_mtd_devicedel_mtd_deviceadd_mtd_device, get_mtd_device_nm mtd_tableQP; nand_read_skip_bad<nand_write_skip_badnnand_erase_optsAQH port_uc_addr_setkirkwood_egiga_initializeed+__div64_32!eUfmd5_wdmd5'icleanup_before_linuxjuraisebi_baudrateinit_baudrate__green_LED_on__red_LED_off__coloured_LED_initboard.cshort int__blue_LED_offinit_fnc_ptrinit_sequencehangdisplay_dram_configbi_boot_paramsbi_envbi_ip_addrbd_tlong long int_armboot_starthave_consoleenv_validreloc_offbd_infounsigned charglobal_data__blue_LED_on__yellow_LED_offulonglong long unsigned intstart_armbootmonitor_flash_len__red_LED_ongd_tenvironment_s__yellow_LED_onshort unsigned intdisplay_bannerversion_stringBootFile_bss_start/disk/u-boot-kc-n/lib_armenv_addrbi_draminit_fnc_tGNU C 4.4.2bi_arch_numberload_addr__green_LED_offdo_software_interruptdisable_interruptsprocessor_modespt_regsuregsenable_interruptsdo_undefined_instructioninterrupts.cshow_regsdo_data_abortbad_modedo_not_useddo_prefetch_abortdo_irqdo_fiqeth_getenv_enetaddreth_deviceis_zero_ether_addreth_registerold_currenteth_getenv_enetaddr_by_indexeth.ceth_state_teth_rxis_valid_ether_addrETH_STATE_PASSIVE/disk/u-boot-kc-n/neteth_get_dev_by_nameethprimeeth_sendiobaseeth_number__def_eth_inituchareth_currenteth_devicesdevnameNetRestartWrapethrotateeth_setenv_enetaddrETH_STATE_INITfirst_restartenv_changed_ideth_initializeeth_get_deveth_get_nameenetvarETH_STATE_ACTIVEeth_get_dev_by_indextarget_deveth_haltfirst_failedeth_parse_enetaddris_multicast_ether_addreth_try_anothereth_get_dev_indexeth_set_currentudp_xsumsportip_srcfromip_idNetArpWaitTry__fswab32NetOurGatewayIPNetLoopfragNetCopyIPNetBootFileSizeet_protRARPvet_typeNetOurRootPathNetDefragmentgatewayip_dsticmphNetSetEtherar_hrdvet_destnretryudp_srcNetRxPacketNetOurNativeVLANNetEtherNullAddret_protlenPingSeqNochecksumNetArpWaitPacketBufip_sumip_tosNetSetIPNetServerIPlenpNetArpWaitTxPacketpacketHandlervet_tagNetSendUDPPacketstartAgainTimeoutNetOurNISDomainNetOurHostNameet_ssapudp_dst__u16dportrandom_portar_proNetOurSubnetMaskNetStateNetEthHdrSizeNetDevExistsinpktTFTPtimeHandlerPingTimeoutrxhand_fip_lenNetOurEtherNetBootFileXferSizeNetArpWaitTxPacketSizeNetTxPacketnet_check_prereqar_dataNetOurIPstring_to_VLAN__u32BOOTPicmphdrvet_vlan_typetimeStartIP_tNetOurVLANNetRxPacketLenNetBcastAddrPktBufproto_tet_snap1et_snap2et_snap3timeDeltaNetStartAgainArpTimeoutCheckip_ttlgetenv_IPaddrstartAgainHandlerudp_lenNetRxPacketsNetArpWaitTimerStartNetSetTimeoutNetWriteIPVLAN_Ethernet_tNetReceiveNetOurDNSIPNetSendPacketip_offBootpTryPingHandleretheret_dsapcopy_filenamePingSendRarpTryVLAN_to_stringIPaddr_tARP_tgetenv_VLANICMP_tNetCksumNETCONSprotocolArpRequestNetReadIPthand_fNetArpWaitPacketIPNetPingIPnoretrystring_to_ipar_hlnNetArpWaitReplyIPDHCPushortNetRestartedNetInitLoopNetSetHandlerPINGonceip_hl_vmyvlanid__unusedPingStartip_pNetServerEthermynvlanidNetArpWaitPacketMACuint__fswab16NetCksumOkNetIPIDar_plnet_ctlip_to_stringSNTPar_opvet_srcnfs_read_replynfs_readlink_reqnfs_read_reqpktlenfnamelenNfsSendNfsOurPortrpc_lookup_replyfnamerpc_procrpc_progNfsTimeoutCountrstatusnfs_filenamenfs_offsetnfs_readlink_replyuint8_tOurNetnfs_mount_replyServerNetdirnamehostnamenfs_lenNfsSrvMountPortdatalennfs_mount_reqNfsStatenfs_lookup_replynewsizecallNfsTimeoutnfs_umountall_reqbasenamerpc_idnfs_path_buffnfs.cNfsServerIPdefault_filenameastatushostnamelenrpc_add_credentialsnfs_pathuint32_tnfs_umountall_replyNfsSrvNfsPortrpcversrpc_pktpathlenrpc_reqnfs_lookup_req__u8verifierstore_blockNfsDownloadStatefs_mountedNfsStartdirfhfilefhNfsHandlerrpc_trpc_lookup_reqdummi0dummi1dummi2dummi3RarpHandlerrarpRarpTimeoutrarp.cRarpRequestTftpBlockTftpBlockWrapTftpBlkSizeTftpLastBlockTftpStatetftp_filenameTftpBlkSizeOptionprototftp.cTftpServerIPTftpTimeoutCountTftpStartTftpTimeoutMSecsTftpTimeoutTftpRRQTimeoutMSecsTftpRRQTimeoutCountMaxTftpTimeoutCountMaxTftpBlockWrapOffsetTftpServerPortTftpSendTftpHandlerTftpOurPortbp_chaddrDhcpExtendedpoptbp_fileiplenBootpRequestext_lenbootp.cdhcp_stateretvalBOUNDtmp_ipOfferedIPbp_snamedhcp_leasetimebp_opmaxlenDhcpMessageTypeRequestedIPmessage_typebp_vendbp_giaddrbp_hopsDhcpHandlerbp_hlenbp_secsbp_siaddrcurlenBootpCopyNetParamsbp_idiphdrINIT_REBOOTSELECTINGBootpIDtruncate_szbp_ciaddrBootpTimeoutNetCopyLongNetDHCPServerIPDhcpOptionsProcessextlenServerIDREBINDINGRENEWINGNetReadLongbp_offerBootp_tbp_htypeDhcpRequestoplenDhcpSendRequestPktREQUESTINGREBOOTINGdhcp_state_tbp_yiaddrbp_spare1BootpCheckPktoob_poinand_oobfreeu_charerasesizeeccposecccalcnand_info_tread_fact_prot_regecccodeput_devicenand_ecc_ctrlooblenmoduleNAND_ECC_NONEotp_infoactiveoobbufmaxchipsnand_init_chip__kernel_size_tpage_shiftnumchipswritesizebadblocksunpointownerchip_shifterase_infomtd_infohwctldev_readyNAND_ECC_HW_SYNDROMEIO_ADDR_Rcmd_ctrlcontrollerIO_ADDR_Wchip_delaypagemaskbbt_erase_shiftooboffsu_int32_tbbt_mdwaitfuncread_user_prot_regcmdfuncnumeraseregionsMTD_OOB_AUTOlockedNAND_ECC_HWdatabufpanic_writeoobsizeNAND_ECC_SOFTusecountcalculatemtd_oob_mode_tnand_ecclayoutnand_ecc_modes_tget_user_prot_infocellinfobbtblockscorrectmaxblocksnand_hw_controlnand_buffersnand_infoeccbytes__u64/disk/u-boot-kc-n/drivers/mtd/nandphys_addr_tbadblockposMTD_OOB_PLACEwrite_user_prot_regnand_curr_devicefail_addrpagebufuint64_tnand_bbt_descrlock_user_prot_regprepadoobavailoobretlenmtd_ecc_statslockmapbase_addresssubpagesizepostpadreserved_block_code__kernel_loff_tdatbufu_longget_fact_prot_infou_intmtd_oob_opschipsizeread_pageNAND_ECC_HW_OOB_FIRSTbase_addrbadblock_patternmtd_erase_region_infoerrstatcorrectedcellsubpage_sftbbt_tddefault_nand_namephys_erase_shiftdev_namenumblocksnand_chipveroffsMTD_OOB_RAWmaf_idxmtd_erase_callbacknand_writebuswFL_SYNCINGPTR_ERR__FUNCTION__bbt_masked_pagenand_block_isbadnand_erase_nandnand_write_page_syndromenand_scan_tailnand_suspendsndrndnand_read_subpagenand_get_flash_typechipnrnand_do_read_opsalignedFL_RESETINGFL_UNLOCKINGaligned_leninstrERR_PTRgeneric_ffserase_exitnand_read_page_sweccwritelenpage_addroobreadlennand_block_badnand_fill_oobfillblkchecknand_flash_devnand_write_oob_syndromenand_syncFL_CACHEDPRGmulti_erase_cmdnand_scannand_commandnand_read_bytenand_manufacturersnand_maf_idnand_set_defaultsnand_read_wordnand_read_buf16nand_do_read_oobsingle_erase_cmdeccsizetoreadnand_resumenand_manuf_idsnand_read_byte16IS_ERRFL_READYrewrite_bbtaligned_posFL_READINGFL_LOCKINGFL_WRITINGnand_read_oobtimeonand_write_oobdata_offsnand_read_page_rawnand_erasenand_check_wpnand_read_page_syndromenand_write_buf16datafrag_lenreadcmdFL_PM_SUSPENDEDnand_oob_16eccstepsnand_release_devicedev_idtmp_idallowbbtthisnand_releasewoffsbufpoinand_write_page_hweccnand_write_pagenand_block_checkbadnand_read_bufnand_read_page_hwecc_oob_firstnand_verify_bufcachedcolumnnand_base.cdata_col_addrnand_write_bufnum_stepsFL_ERASINGrst_sts_cnttmp_manfnand_waitnand_command_lpnand_wait_readywbufnand_verify_buf16nand_default_block_markbadnand_block_markbadnand_oob_128nand_read_oob_stdnand_do_write_oobpages_per_blockstart_stepnand_transfer_oobnand_write_page_sweccnand_flash_idsnand_oob_8new_statenand_write_oob_stdgetchipnand_do_write_opsnand_oob_64ecc_calcnand_read_oob_syndromenand_readnand_read_page_hweccgaps__func__sndcmdecc_codenand_scan_identblockmaskeccfrag_lennand_get_deviceend_stepextidnand_write_page_rawrealpageoldvalnand_memory_bbtlargepage_flashbasedwriteopssftcntsmallpage_flashbasednrblockssftmskscan_write_bbtbbt_patternnand_update_bbtnand_scan_bbtcheck_patternread_bbtbbt_mirror_descrbbtoffsmirror_patternpaglennewvalscan_block_fullsearch_bbtsearch_read_bbtsread_abs_bbtagand_flashbasedrcodecreate_bbtouterrscan_read_rawbbt_main_descrcheck_short_patternblocktopagetotlenstartblockpageoffsnrchipswritechecknand_isbad_bbteinfocheck_createscanlenscan_ff_patternread_abs_bbtsactblocknand_default_bbtnand_bbt.cscan_block_fastscan_agand_patternsmallpage_memorybasedmark_bbt_regionlargepage_memorybasedchipselcountbitstmp1tmp2reg1reg3nand_correct_datanand_ecc_precalc_tablenand_calculate_eccread_eccnand_ecc.creg2bitnumbyteoffscalc_eccnand_ids.cnf_regboard_nand_initrd_paramswr_paramkirkwood_nand.ckw_nand_hwcontrolkw_nand_select_chipkwnandf_registerspostpad_reg9postpad_lcr/disk/u-boot-kc-n/drivers/serialpostpad_regBpostpad_regCpostpad_regDpostpad_regEpostpad_rbrNS16550postpad_osc_12m_selpostpad_msrNS16550_tpostpad_reg12postpad_scrcalc_divisorpostpad_ierpostpad_regA_serial_putc_raw_serial_getc_serial_putsserial_portspostpad_lsrclock_divisor_serial_putcpostpad_uasrpostpad_sprpostpad_fcrpostpad_mdr1serial.c_serial_setbrgpostpad_mcrserial_initpostpad_ssr_serial_tstcns16550.cNS16550_getcNS16550_initbaud_divisorNS16550_putccom_portNS16550_reinitNS16550_tstc/disk/u-boot-kc-n/commonprint_ethdo_bdinfomaxargs__u_boot_cmd_bdinfoargccmd_tbl_trepeatableprint_numcmd_tbl_scmd_bdinfo.ccmdtpdo_godo_go_exec__u_boot_cmd_resetcmd_boot.c__u_boot_cmd_goboot_fnentry_pointrelocated__arch_lmb_reservelegacy_hdr_os_copyih_nameimage_infobootm_headers_tcmd_bootm.cbootm_load_osimage_get_image_sizeendplegacy_hdr_validunc_lendo_bootddo_bootm_subcommandft_lenmem_startkernel_lendo_bootm_netbsdimage_get_magicih_typelmb_propertyconsdevih_compphys_size_tos_hdrimage_check_target_archmem_sizeimage_get_archimage_lenkernel_dataimage_get_loadih_magicbootm_start__arch_preboot_osimage_check_archapplbootm_start_standaloneimage_startih_osimage_get_dataih_dcrcimage_get_osimage_headerblob_endbootm_headersiflagboot_get_kernel__u_boot_cmd_bootimage_header_tcmd_bootm_subloaderdo_iminfoload_endcmdline_endcmdline_startlegacy_hdr_os__board_lmb_reserve__u_boot_cmd_bootd__u_boot_cmd_bootmimage_get_sizeinitrd_startih_archih_load__u_boot_cmd_iminfoimage_get_image_endih_timeih_sizeih_hcrcos_dataih_epimage_get_epimage_check_magicimage_info_tdo_bootminitrd_endblob_start_ctypedo_bootm_rtemsimage_get_data_sizeimage_get_header_sizeimagesimg_addrimage_get_typeverifyimage_get_compos_lenimage_get_kernelboot_os_fnimage_check_typelmb_region__u_boot_cmd_coninfodo_coninfo__mptrstopcmd_console.cstdio_devprefetchlist_headstdio_devicesstdio_namesevalexparg1arg2op_tablebinary_testopcodecmd_itest.coptpstringcompdo_itest__u_boot_cmd_itestevalstrop_tbl_sop_tbl_tarithcompchk1XF_get_timerload_serial_ymodemstore_addrline_countstart_addrlen_loXF_getcgetcxmodemXF_spi_release_bushis_pad_charXF_do_resetXF_tstcbin_data_charXF_i2c_writes1_sendpacketsend_ackXF_strcmpXF_getenvend_addrXF_spi_claim_busos_data_initbinlenXF_spi_free_slaveXF_get_versionhis_eolos_data_saveos_data_addrconnection_info_tos_data_addr_saveddo_load_serialk_data_initbinbufenv_echoXF_udelayXF_simple_strtolos_data_stateXF_install_hdlrk_state_savedXF_MAXXF_spi_initktransymodemBufk_data_escape_savedXF_mallocXF_free_hdlrXF_setenvload_baudrateos_data_charos_data_state_savedXF_vprintfbin_data_initXF_spi_setup_slavenew_charSTART__u_boot_cmd_loadb__u_boot_cmd_loadsXF_spi_xferXF_putcdoneXF_putsXF_forceenvhandle_send_packetXF_freeXF_printfhis_pad_countk_data_restorek_recvos_data_restoresend_parmsread_recordk_statelen_hicurrent_baudrateXF_simple_strtoullast_ncmd_load.ck_data_escapehis_quotedo_echoXF_i2c_readsend_ptr__u_boot_cmd_loadybin_start_addressset_kerm_bin_modepacket_errordo_load_serial_bink_data_savek_data_charsend_padsend_nackaddr1addr2incrflag__u_boot_cmd_md__u_boot_cmd_mm__u_boot_cmd_mwdo_mem_crcmm_last_size__u_boot_cmd_crc32do_mem_mddo_mem_mmmod_memdp_last_lengthjunkdo_mem_mw__u_boot_cmd_nmiteration_limit__u_boot_cmd_mtestmm_last_addr__u_boot_cmd_cmp__u_boot_cmd_cpngoodbyte1byte2do_mem_loopdo_mem_mtestconsole_bufferdo_mem_basereadback__u_boot_cmd_loopdo_mem_nmshortp__u_boot_cmd_basedo_mem_cpcmd_mem.cwritevalincrnbytesdp_last_sizehword1hword2iterationsdp_last_addrlongpdo_mem_cmpcmd_misc.c__u_boot_cmd_sleepdo_sleepmtddevnumdev_typepart_parsedevice_delalllast_idsdevice_addid_find_by_mtd_idpart_delallmtd_devices_initdouble_entrycurrent_mtd_partnumcdevdelete_partitiontmp_epcurrent_mtd_devcurrent_save__list_delpart_cntcurrent_partitionpentrylist_add_tailsector_sizenum_partscleanuppart_validate_eraseblockid_findparse_mtdpartsids_changedpartdefmtd_device_validateid_tmpinitializeddevice_deldev_tmpdo_chpartauto_namepart_validatemtdparts_initretpartdevice_parsebuflengenerate_mtdpartslast_partsdev_nummtd_id_parsedevice_find__u_boot_cmd_chpartlist_partitions__u_boot_cmd_mtdpartsfind_dev_and_partcmd_mtdparts.cpnummtdids_defaulttmpbufretdevmtd_part_infomemsize_parsename_lengenerate_mtdparts_savecurr_pidnumlast_partitiontmp_listpart_addmtd_id_lenlist_emptypart_nummemsize_formatdo_mtdpartsINIT_LIST_HEADjffs2_privpart_tmplinkstart_okindex_partitionspart_sort_addret_id__list_addnew_piparse_mtdidscurrent_save_neededend_okmtdparts_defaultdentrymask_flagspart_delprev_partretptrlocal_argsnand_erase_options_t__u_boot_cmd_nbootendptrstr2longnand_erase_optionsarg_off_sizecleanquiet_strcmd_nand.cquietnand_load_imageonly_oobdo_nandnand_print_infomtd_oob_ops_tboot_device__u_boot_cmd_nanddo_nandbootjffs2nand_dump__u_boot_cmd_ping__u_boot_cmd_rarpbootdo_tftpb__u_boot_cmd_dhcpcmd_net.cnetboot_update_envdo_rarpb__u_boot_cmd_nfs__u_boot_cmd_bootpnetboot_commondo_pingdo_nfsdo_dhcpdo_bootp__u_boot_cmd_tftpboot__u_boot_cmd_printenvget_env_id_do_setenvgetenv_rvarvalueenvmatchbaudrate_table__u_boot_cmd_setenv__u_boot_cmd_saveenvvarnameenv_dataenv_name_spec__u_boot_cmd_runcmd_nvedit.cdo_saveenvdo_printenvfit_uname__u_boot_cmd_sourcedo_source__u_boot_cmd_autoscrcmd_source.cdo_autoscr__u_boot_cmd_imxtractdo_imgextractcmd_ximg.cpromptdo_versionvar_completeprint_argv__u_boot_cmd_versioncmd_itemscomplete_cmdv_do_helpmaxvlast_charclenfind_common_prefix__u_boot_cmd_echodefault_sizetmp_buf__u_boot_cmd_endmake_argvleaderspacecmd_get_data_sizecmd_auto_completefind_cmdputnlcmd_usage__u_boot_cmd_startcolpn_foundinstall_auto_complete_handlerfind_cmd_tblargvszcommand.cswapsinstall_auto_completeseplen__u_boot_cmd_question_marklinemax__u_boot_cmd_helpanchorcmdtp_tempcmd_arraytable_lenconsole_putcconsole_putsfputcfputsconsole_init_fconsole_init_rhad_ctrlcconsole_setfileinputdevfprintf__gnuc_va_listclear_ctrlcoutputdevconsole_getcconsole_tstc__apstdio_print_current_devicesconsole_assignfgetcftstcctrlc_was_pressedsearch_deviceserial_printfctrlc_disableddisable_ctrlc__va_listprintbuffernewptop_padtrim_thresholdmalloc_trimnextsizeold_endmem_malloc_startpvallocold_topfordblksoldpstartidxmem_malloc_endoldtopcorrectionmalloptremaindermem_malloc_brkhblkssplitold_top_sizefront_misalignsbrkmcsrcmem_malloc_initcurrent_brkmmap_thresholdarenamax_total_memmalloc_usable_sizeprevszprev_sizeincrementvictim_sizememalignmcszparam_numbermcdstnewmemvictimmalloc_chunksbrk_basemzszelem_sizeuordblksn_mmaps_maxfsmblksmbinptrkeepcostextramchunkptr__kernel_ptrdiff_tcurrent_mallinfopageszoldmemnew_brkmalloc_extend_topdlmalloc.cnextszremainder_sizemmapped_memprevsizeoldtopsizemax_sbrked_memreallocusmblksmalloc_bin_relochblkhdsbrk_sizealignmentislrleadsizeoldsizeremainder_indexbufszenv_common.cenv_completeenv_tlvalenv_get_char_memoryenv_relocateenv_ptrenv_get_charenv_get_char_initenv_crc_updatevallenset_default_envdefault_environmentrvalenv_get_addrblocksizeenv_get_char_specenv_inituse_defaultchar_ptrreadenvenv_nand.camount_savedamount_loadedenv_relocate_specwriteenvdummyexports.cjumptable_initrd_lengenimg_get_type_idrd_hdrimage_get_dcrcimage_check_osgenimg_get_comp_nameram_addrimage_check_dcrcuimage_archget_table_entry_namegenimg_get_os_idgenimg_get_arch_namegetenv_bootm_sizememmove_wdimage_print_contentstable_entry_trd_dataimage_get_hcrcchunkszimage_check_hcrcimg_datalnamegenimg_get_arch_idgenimg_get_imagegetenv_yesnogenimg_get_type_nametable_nameboot_get_ramdiskuimage_osgenimg_print_sizetable_entryimage_get_nameimage.cgetenv_bootm_lowuimage_typegenimg_get_formatimage_set_hcrcrd_addruimage_comprd_loadget_table_entry_idgenimg_get_os_nameimage_get_ramdiskgenimg_has_configimage_print_typegenimg_get_comp_idimage_multi_getimgimage_multi_countmain.cinputprocess_macroserase_seqhist_lineshist_numstrsizereadline_into_buffervarname_startdo_runicharreadlineesc_savemain_loopbootdelayoutputlastcommandesc_len__show_boot_progressinquoteshist_initenvnamehist_maxparse_lineinputcnthist_add_idxoutputcnteol_numenvvalnum2nargswleninittedfinaltokenhist_nextinserthist_curdelete_charold_curhist_prevcmdbufhist_listcread_add_chartab_seqabortbootcread_add_strcread_linerun_commandenvcnthlinecread_add_to_histloop_cntmiiphy_get_current_devmiiphy_readmiiphy_infonew_devmii_devmiiphy_speedmiiphy_duplexbmcrfound_devmii_devsmiiphy_listdevread_retmiidevmiiphy_registerwrite_retcurrent_miimiiphy_resetmiiphy_set_current_devanlparmiiphyutil.cmiiphy_read_failedmiiphy_is_1000base_xmiiphy_writemodelmiiphy_initchksumsrec_decodesrec_types_record.chex1_binhex2_binstdio_get_by_namedrv_system_initstdio_initstdio_get_liststdio_clonestdio_registerstdio.cresultxyzModem_stream_closexyzModem_stream_terminatetotal_CANhdr_found_is_hexbufpcrc_retriescblknext_blkread_lengthdelimboolat_eoftx_ackxyzModem_errortotal_STXcan_totalCYGACC_COMM_IF_PUTCCYGACC_COMM_IF_GETC_TIMEOUTcounterparse_numxyzModem.cradixxyzModem_stream_readcrc_modexyzModem_stream_openfile_lengthcrc1crc2_tolowertotal_retriesxyzModem_flushdigithdr_charsxyzModem_get_hdr_from_hex__chantotal_SOHreset_phykwmpp_config/disk/u-boot-kc-n/board/Marvell/tk71maddrtk71.cboard_initdevadrmv_phy_88e1118_initdram_initcrc16_tabuint16_tcyg_crc16crc16.c/disk/u-boot-kc-n/lib_genericBytefcrc32.ccrc32_no_compuIntBytecrc_tablechunk_szcrc32_wdctype.cdisplay_optionsprint_bufferlinebuflinelendisplay_options.cdstlenoutcbzalloccb_funcstoponerrzunzipgunzipalloc_functotal_intotal_outavail_outadlerinternal_statenext_outdata_typevoidpfuLongz_streamzfreeopaquenext_infree_funcz_stream_savail_ingunzip.clmb_addlmb_align_downlmb_coalesce_regionslmb_addrs_overlap_rgnrgnbeginlmb_alloclmb_dump_all__lmb_alloc_baselmbsizelmb_is_reservedlmb_addrs_adjacentlmb_initlmb_align_uplmb_add_regionrgnsizelmb_overlaps_regionlmb_remove_regionlmb_regions_adjacentlmbbasesize1size2lmb.cmax_addrrgnendlmb_freecoalescedres_basebase1base2rgnbasestrnlenstrncpystrpbrkmemcpystrncmp__res___strtokmemscanmemcmpmemsetstring.cmemmovestrchrbcopysbeginstrcatstrlenstrcpyacceptstrspnmemchrstrsepstrdupstrstrstrrchrstrswabstrncatneed_pfxip4_addr_stringfield_widthip6_addr_stringrepeatpanicip6_addrput_dec_full__touppervsprintf.cdigitshex_ascpack_hex_bytemac_address_stringlocaseput_decmac_addrvsprintfip4_addrput_dec_truncqualifierskip_atoipointerustrtoulprecisionlastinflate_fastWASHDICTIDinflateResetTIMEinflateInit2_dmasklcodezcallocHCRCdistfixinflateEndinflate_tablecommentLENGTHz_streampxflagsDICTlenswbitsDISTzlib.cCODELENSdextdistcodeDONElmasklencodeDISTEXTdodistadler32MATCHinf_leavesum2distbitsEXLENTYPEDOorderEXTRAlenbitswindowBitsNAMEhbufhavedictfixedtablesBADCODEinflatelenfixinflate_statendistinflate_modeinflateInit_TYPEgz_headerrootTABLEzcfreeLENEXTwhavedolenFLAGSworkleftz_errmsgdbaseCODEShuffupdatewindowname_maxdmaxwrapCOMMENTextra_lengz_headerpstream_sizecomm_maxdropDISTScodesCOPYdcodeLENLENSSTOREDgz_header_slextSYNCcodetypelbaseextra_maxCHECKstrmBANK3/disk/u-boot-kc-n/cpu/arm926ejs/kirkwoodkw_sdram_bsmemory_bankkw_sdram_bardram.cBANK0BANK1BANK2rstoutn_masksizevalKWCPU_ATTR_NANDFLASHkwgpio_registersmppregreadfr_extra_feature_regkw_config_adr_windowsget_random_hexgpp1_oeKWCPU_ATTR_PCIE_MEMftdll_configKWCPU_TARGET_1RESERVEDgpio0reggpp0_oe_valctrl_statremap_hikw_winctrl_calcsizegpp1_oe_valmpp48_55kwcpu_targetKWCPU_TARGET_SASRAMKWCPU_ATTR_SPIFLASHirq_levelirq_maskKWCPU_ATTR_DRAM_CS0KWCPU_ATTR_DRAM_CS1KWCPU_ATTR_DRAM_CS3irq_causepad1pad2arch_misc_initKWCPU_TARGET_PCIEl2_cfgdoutgpio1regoutbufKWCPU_ATTR_PCIE_IOmpp8_15print_cpuinfoblink_enKWCPU_ATTR_BOOTROMsysrst_cntKWCPU_TARGET_RESERVEDKWCPU_ATTR_DRAM_CS2kwcpu_winenKWCPU_WIN_ENABLEkwwin_registerskw_sysrst_actionkw_config_mppkwcpu_registersremap_lowinregskw_sysrst_checkKWCPU_WIN_DISABLEKWCPU_TARGET_MEMORYignoredkwcpu_attribgpp0_oearch_cpu_initkw_config_gpioreset_cpuahb_mbus_mask_irqmpp32_39din_polwritefr_extra_feature_regsys_soft_rstmpp16_23mpp0_7sysrst_dlyset_crKWCPU_ATTR_SASRAMcpuregcpu.cmpp40_47invalidate_l2_cachecpu_eth_initmpp24_31get_crahb_mbus_cause_irqmpp.cmpp_listvariant_maskkirkwood_variantmpp_ctrlkirkwood_mpp_conftimestampcntmrctrlkwtmr_regsusecwdt_reloadtimer.ctimer_initdelayticksreset_timerkwtmr_registerswdt_valkwtmr_valget_timer_maskedlastdecreset_timer_maskedsetup_memory_tagsvideo_pagemachidtag_headermemc_control_regsounddefaultdo_bootm_linuxtag_videolfbsetup_commandline_tagrsvd_possetup_end_taghighlfb_linelengthvideo_linestag_serialnrtag_ramdisktag_initrdvideo_colstag_mem32fmemclktag_acorntag_cmdlinevideo_pointslfb_baseblue_posvideo_isvgatag_videotexttag_coretag_memclkvideo_modelfb_widthtag_revisionred_sizetheKernellfb_depthgreen_posblue_sizevideo_ega_bxrsvd_sizelfb_heightsetup_initrd_tagrootdevlfb_sizecommandlinered_possetup_start_taggreen_sizevram_pagesadfsdrivesdummy1dummy2cache.cflush_cacheicache_disablecache-cp15.ccp_delaydcache_enabledcache_statusdcache_disablecache_biticache_enableicache_statusreset.cget_mtd_deviceout_unlockadd_mtd_devicemtd_tableput_mtd_devicedel_mtd_deviceget_mtd_device_nmmtdcore.c/disk/u-boot-kc-n/drivers/mtdp_bufferwrite_sizeget_len_incl_badblock_offsetnand_read_skip_badbbtestnand_write_skip_badjffs2_unknown_nodeleft_to_writecleanmarkermeminfonand_util.c__basenand_block_bad_old__remleft_to_readpriv_nandnand_block_bad_scrubpercent_completeblock_lenpercentoob_optslen_excl_badhdr_crcerase_info_terase_lengthnodetypenand_erase_optscmd_stspad20_1smi_reg_readpad22phyadrtcqdpha_remapstop_queueKWGBE_WIN1datasizeKWGBE_WIN5kwgbe_targetkwgbe_initkwgbe_txdesceth_type_priomrvl_headeruc_nibbleKWGBE_TARGET_PCI0KWGBE_TARGET_PCI1kwgbe_adrwinp_rxdesc_currp_rx_descpmtutqxtbctable_indexkwgbe_barszpmbus_top_arbiterbareset_dram_accessnxtdesc_ppxmfshitkninasyncpkterror1error3buf_sizeqregeuicpeimeuimpttbrcreg_datapad3pad4pad5pad6pad7pad8pad9p_rxbufkwgbe_recvport_init_mac_tablesport_uc_addr_setpsc0psc1buf_ptrpmtbskirkwood_egiga.cpttbcpxcxKWGBE_TARGET_CBSset_access_controlerror2access_prot_regerror4kirkwood_egiga_initializedscpqxttbctqxpaddfuttqfpckwgbe_winparamtqxipg0tqxipg1reg_offsetmac_hkwgbe_haltmac_leudidkwgbe_deviceKWGBE_TARGET_DEVevlanehigh_addrKWGBE_WIN0l4i_chkKWGBE_WIN2KWGBE_WIN3KWGBE_WIN4pxdfcdataptrKWGBE_TARGET_DRAMp_rxdescphy_adrmacahpxtfutmacaleudatqxacp_aligned_txbufhitkninlopktoptionpeuiaeunicast_regvpt2pepaprxcdp_padlotkninasyncpkttqc1kwgbe_registerssmi_reg_writekwgbe_sendsmi_regmii_ser_paramspad10pad11pad12pad13pad14pad15pad16pad17pad18pad19tcsdpdkwgbedfsmtkwgbe_tqxrxcdp7timeoutpad20pad21pad23win_paramtbl_offsetkwgbe_init_rx_desc_ringkwgbe_rxcdpused_portskwgbe_rxdescdfomtp_txdescreg_ofsaccess_ctrl/disk/u-boot-kc-n/drivers/netbyte_cntpxofceueaport_uc_addrpad3adiv64.c__div64_32md5.clongscontextMD5InitbyteReverseMD5UpdateMD5Finalmd5_wdMD5ContextdigestMD5Transformcache_flushcleanup_before_linux/disk/u-boot-kc-n/cpu/arm926ejssignumeabi_compat.craise48pdh H8D0 0 4 $ ,   H P h t ` d T X  4 x  4 x   XhlpXhlpH48L48Lx 0 pL  `hlp`hlp04X`|$8DDLlXdDLlXd\D , | | |H T X \ H T X \ l p | | l p | |   DdDd @D$< @D$< h l  H  @ 0 4 < @ D L `(p""""x#|###))))++++0h102H23038H93333p33\3l3H3X343D333H995 845343333H995 8453433,707<77,707<77L 4P4P0@\PHLPPHLPP P 8 P 8 $ T D\x|\t\t <@DH\`p\`pTl|Tdld8Tl|Tdld8l|TdTd8l|TdTd8T \ t l  < X p T T ||d|d| ,,DDd  0| p  | p  | p   p  t | t t t |  t  t  Xh$hlx|LX\pxdldlpx$(8@,4,48@((X P d X P d    `    ` p x | p x | \ T \ T  ,0 $@DPXl <,<00<,<00 <,<0<0T<0Thlp@$@$(!`"T!h!@T<(!`"T!h!@T< !`"4 !`"4"," "$"!"H"`"h`""!!!!`""!!`""!!h"x"`"d"!!h"x"xx!!P!h!!P!h!!(<@d@dtt , ( 4 @xL  84L (L (\` 8< 4Tl,<H\phlt04t04@ 0 4,0P@ 0 4,0PTTP P   8X x @ P 8X x @ P \`d\`d 8 H X < D 8 < D dlt HPX<xxhpt|4<\d@HTXpp dhtx|<<<<00||<@D|<@D| @ 8 $  @ 8 $ X h X h (,  (,   Pl8@$4 \ @  \ @ 4L\ DLDLDL \   |8HX|ptx<D,8( <D,8( T|Ld8<Td@Ld$|@pdh@L@L\HT \HT  x|x|   @D H@D H(@DH @ $ 4@`dX\DT||h""<dh""<dptxptx8<@P8<@P,4  hhlx|tdd88LX\LX\  ,4DL<@\PXL<@ 4 Pp (<@Tdd|DD\\pp $ ( ` x H P 0 D .symtab.strtab.shstrtab.text.rodata.data.u_boot_cmd.bss.ARM.attributes.comment.debug_line.debug_info.debug_abbrev.debug_aranges.debug_frame.debug_loc.debug_pubnames.debug_str.debug_ranges` !asn)ab/xb;}b`]@p'P0Yfe:qq8nh|CqK(0mt_k+; , t. y /`aabxb}b     P`` `!$`5(`E,`Q0`[4``8`e `h`~@`````` `@`P````````e``e `e```0e``#` e``2``e\`d`e`eaeabebe}be @`e``e(`,`eL`P`ep`t`e``e``e``e``e$`e aM aeXbe< W(`](`e<`@`e``e``e$ `( `eX `\ `e ` `e ` `e ` `e ` `e4 `H `e ` `e ` `e ` `e ` `e`eae be}bl}bx}b}b}b}bel  ` `e0`4`4`eD`H`e``e``e``e``e0`4`e```eD`P`eT`d`d`e|``eP`l`e```<e``eH`L`e``e\```e``e0``e%`eaebbe be}b}b }b}b#}b-}b:}bG~bP"~bZtbex n4&`t4&`L}&`ep'`t'`t'`eD(`L(`L(`e(`(`(`e)`)`)`e4*`8*`8*`(eL+``+``+`e+`+`+`e,`,`,`\e,`,`,`e-`-`-`e@.`H.`*H.`Xe.`.`;.`e.`.`e/`(/`e 1`Cd1`HNl4`d1`e1`1`Y1` e2`2`l2`eL4`l4`e4`4`e\6`ebb{bbeL+bebbbbbb ȣb bbbbbbbb b@1Dbe A6`e\7`H7`HT7`\7`e7`7`e8`ebeHbeP `(8`g(8`e\8`p8`e9`9`e<`pt<`d|<`t<`e<`<`e?`e bb bb(bb,bb4bbebeLbLbPbЬbԬbجb ܬb b b&b4bHbe V?`^?`eC`kC`Hx4G`C`e D`D`D`e`D`lE`eG`4G`eJ`eDbebeh K`eL`eaae8bbePbebȭbخbe`  L` L`8L`HL`\L`lL`4!L`,/L`\?(M`4P\M`<`M`drM`N`<O`8LO`0|P`$S`X|T`HU`<W`D'DW`>\X`pQX`i|Z`4}Z`t[`P\`X]`<]`]`]` e]`^`^`e^`^`e,_`@_`ec`e`Xr`!Dz`+l`6w`Dl`Sa>a>ae>a>ae>a?ae?aeubePbe|be+ ?a?aed@ae, @aeHAaPAaeAaAaeAaBaePBaXBaeBaBaeBaBaeCaCaeCa CaePCaTCae@DaHDae|DaDaeDaDae`HaHae(KaeububHubvblwb<eQbe$- \KaeLaLaeHPaXPaePaPaPaeQaQaQaeRaRaebeT/ O^ae^a^ae0^a4^ae^a^ae4_a@_ae_a_aep`a|`aeaa aaeaaaaehbalbaebabaecaeVbeb\bebe0 qca|ca|edadae82 faefafaexga|gaegahaeXhaewbeXbebb<e2 \haeiaiaejajaepjatjaedkalkalka$eka laexnanaeHqaLqaeraeaa eXbe4b4b<e3 rae|sasaesataetaeaaaeYbeP4 taetaeaae4 tae vavae$wa(waeaae5 ewb ,waewaxaexa$xaezaepYbe`5 ,zae{a({ae{a{aeYbe5 &|a,4|aTePaTaeZbe`6 ;\aeaaepbe7 D ae,a0ae|aaOHa]$ae a,ae,aheaaeaalaeaae adae a\ae@aԖae@aLaeasaeLZbe9 |aeDaPaeaaeaae\alaeHaaeaHaeaa>a>4a@ta@ab4b&e\Zbe ; ae aae@aep< Daehapae8a`aeaaeaae0aDae ae> ae> %aeaeD]be4? - aeaaeaaeaaeaaeaeT]bebe`? 7aCaXaea aeaaeae]be? i4azae@ahaa$axaDa$xae0aDaePahaea$aeaaeaebbbb b  b e$`be@ aeA #a)a, eHaDa6Da<@a@e0aaLXPa~bzb{b0a(a*`/EaDlhbPS`X` atg`vBaxbl`tax`4a<<^al``}b|a` tyb (/`<)K`3XybF4^a[Calbwa`"`pzbzb`a4`(6`4alt'a@b P`$`Kaa$%pb/a8< a E~b\@aLq#a(\Ba}b`H}bub\\a `a~b Db$a#a `()aP8|aE`xQ+aXb hbbua`D a|iaXP{bBaab0Daa`H`8aPzb @_a,&aH:alL